[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85835.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  143/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.68.8
:189 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   90->185 2d9iA PDBj 7e-19 27.9 %
:RPS:SCOP  96->181 2d9iA1  d.68.8.1 * 2e-18 30.3 %
:RPS:PFM   99->181 PF01713 * Smr 1e-11 45.7 %
:HMM:PFM   99->181 PF01713 * Smr 6.9e-27 49.4 81/83  
:BLT:SWISS 38->90 NKTR_MOUSE 5e-04 34.0 %
:BLT:SWISS 80->183 YDAL_ECOLI 3e-08 32.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85835.1 GT:GENE AAK85835.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 6974..7543 GB:FROM 6974 GB:TO 7543 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK85835.1 GB:DB_XREF GI:15154868 LENGTH 189 SQ:AASEQ MKGSRKLGKEERILWGRVAKTTRPISGRLEDLLAFDDVEEHPLEPSVPQTGKSAFPRMIVETAEALPASPDKKPKTHQPMEKPVKRKLTRGRLPLEGRIDLHGMFQSEAHAVLLDFLLRAHERGLRHVLVITGKGRSIGSDGALKRAVPMWFAKPEYRYLISSYEDASANHGGDGALYVRLSRRRGEKS GT:EXON 1|1-189:0| BL:SWS:NREP 2 BL:SWS:REP 38->90|NKTR_MOUSE|5e-04|34.0|53/1453| BL:SWS:REP 80->183|YDAL_ECOLI|3e-08|32.7|101/187| RP:PDB:NREP 1 RP:PDB:REP 90->185|2d9iA|7e-19|27.9|86/96| RP:PFM:NREP 1 RP:PFM:REP 99->181|PF01713|1e-11|45.7|81/83|Smr| HM:PFM:NREP 1 HM:PFM:REP 99->181|PF01713|6.9e-27|49.4|81/83|Smr| RP:SCP:NREP 1 RP:SCP:REP 96->181|2d9iA1|2e-18|30.3|76/83|d.68.8.1| OP:NHOMO 143 OP:NHOMOORG 143 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-1111111111111111111111111-11111111111-111111111111111111111111111-----------11111--1-----11---------------1111--1--1------1111-1111111-111111111-----------------11---11------------------------1111-1111----1-11111111--11-------------------------------1-----------------1----11----1--1--------------------------------------------------------------------------------------------------1111------------------------------------11---111------------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 86 STR:RPRED 45.5 SQ:SECSTR #########################################################################################ccccccccEEEcTTccHHHHHHHHHHHHHHHHHHcccEEEEEccccGGTTcTTcHHHHHHHHHHH##########TTccEEcccTTcEEEEccccc#### DISOP:02AL 1-6, 8-9, 27-61, 69-83, 185-189| PSIPRED ccccccccHHHHHHHHHHHHHHHccccccccccccccccccHHHHcHHHcccccccHHcccccccccccccccccccccccHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHHHHccccEEEEEEEEccccccccHHHHHHHHHHccccccccEEEEccccHHccccEEEEEEEEccccccc //