[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85836.1
DDBJ      :             transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->41 3f52E PDBj 6e-06 54.3 %
:RPS:PDB   1->102 2ebyB PDBj 1e-15 18.3 %
:RPS:SCOP  4->73 1b0nA2  a.35.1.3 * 3e-14 23.9 %
:HMM:SCOP  4->70 1ic8A2 a.35.1.1 * 1e-13 44.4 %
:RPS:PFM   8->62 PF01381 * HTH_3 1e-07 38.9 %
:HMM:PFM   8->58 PF01381 * HTH_3 2.4e-17 32.0 50/55  
:BLT:SWISS 1->103 RGHRB_BACSU 2e-07 29.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85836.1 GT:GENE AAK85836.1 GT:PRODUCT transcriptional regulator GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 7540..7905 GB:FROM 7540 GB:TO 7905 GB:DIRECTION + GB:PRODUCT transcriptional regulator GB:PROTEIN_ID AAK85836.1 GB:DB_XREF GI:15154869 LENGTH 121 SQ:AASEQ MTPFAEAVRQLRERKGVTQKEMAAAIGVSPAYLSALEHGKRGKPSFDLLQRIAGYFNIIWDEAEELFFLAGSSDPKVVIDTVGLPPQYTAFANRLARDIRKLPPSVVEELSAVLQKSRSCD GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 1->103|RGHRB_BACSU|2e-07|29.0|100/139| BL:PDB:NREP 1 BL:PDB:REP 7->41|3f52E|6e-06|54.3|35/78| RP:PDB:NREP 1 RP:PDB:REP 1->102|2ebyB|1e-15|18.3|93/98| RP:PFM:NREP 1 RP:PFM:REP 8->62|PF01381|1e-07|38.9|54/55|HTH_3| HM:PFM:NREP 1 HM:PFM:REP 8->58|PF01381|2.4e-17|32.0|50/55|HTH_3| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 4->73|1b0nA2|3e-14|23.9|67/68|a.35.1.3| HM:SCP:REP 4->70|1ic8A2|1e-13|44.4|63/94|a.35.1.1|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 35 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1------------11111111111---------111-11111111111111---------------------1----111----------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 97.5 SQ:SECSTR ccHHHHHHHHTHHHHTccHHHHHHHHTccHHHHHHHHTTccccccHHHHHHHHHHHTccHHcHHHHHHHHHHHHHHHHHTcHHHHHHcccHHHHccccHHHHHHHHHTccEEEEEEEE### DISOP:02AL 120-122| PSIPRED ccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccc //