[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85866.1
DDBJ      :             Hypothetical Protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:164 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->96 PF10947 * DUF2628 6e-16 24.7 93/108  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85866.1 GT:GENE AAK85866.1 GT:PRODUCT Hypothetical Protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(43288..43782) GB:FROM 43288 GB:TO 43782 GB:DIRECTION - GB:PRODUCT Hypothetical Protein GB:PROTEIN_ID AAK85866.1 GB:DB_XREF GI:15154905 LENGTH 164 SQ:AASEQ MTSYLVLEAPNGPDRDHKTTRFIADRFVWLALIAPWLWLAVNRLWLTTAVVVIATLVAGQISMLAGFEPVGILLGFAIGLITALEGRDFLVRHLIRKGWTLTSVISAPDLSSAEDIYFSSLSENADKAEQLSRPVWTTSAQKSGGKNFVDDPAGSFLFDLNGRR GT:EXON 1|1-164:0| TM:NTM 2 TM:REGION 20->42| TM:REGION 67->89| SEG 29->40|wlaliapwlwla| SEG 44->58|lwlttavvviatlva| HM:PFM:NREP 1 HM:PFM:REP 4->96|PF10947|6e-16|24.7|93/108|DUF2628| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 122-147, 163-164| PSIPRED ccEEEEEEcccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHccccccccccccccccHHHcccccccccccccccHHHHccccc //