[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85892.2
DDBJ      :             recF-like protein
Swiss-Prot:RECF_AGRT5   RecName: Full=DNA replication and repair protein recF;

Homologs  Archaea  0/68 : Bacteria  389/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:375 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->364 2o5vA PDBj 9e-16 30.9 %
:RPS:PDB   289->345 2bifA PDBj 2e-04 6.2 %
:RPS:SCOP  7->81,270->342 1f2t.1  c.37.1.12 * 9e-11 28.0 %
:HMM:SCOP  5->376 1w1wA_ c.37.1.12 * 1.5e-35 28.7 %
:RPS:PFM   7->108 PF02463 * SMC_N 2e-05 34.4 %
:HMM:PFM   7->359 PF02463 * SMC_N 5.8e-21 29.0 186/220  
:BLT:SWISS 1->375 RECF_AGRT5 0.0 100.0 %
:PROS 126->146|PS00617|RECF_1
:PROS 317->335|PS00618|RECF_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85892.2 GT:GENE AAK85892.2 GT:PRODUCT recF-like protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 76045..77172 GB:FROM 76045 GB:TO 77172 GB:DIRECTION + GB:PRODUCT recF-like protein GB:PROTEIN_ID AAK85892.2 GB:DB_XREF GI:159139484 LENGTH 375 SQ:AASEQ MTNKVSLSRLKLTDFRNYAAAALVLDERHVVLTGDNGSGKTNLLEAVSFLSPGRGLRRAVLSDVTRVGAEATGFSIFADVDGMDGEVAIGTGIEGDGEVVSRRLRLNGTPVKSVDELTDHLRVLWLTPAMDGLFTGSSSDRRRFLDRLVLSLDPGHGRRASDFEKAMRGRNRLLSEGRFDPVWLDGIEKQMAELGISMAVARYEMLGLLKTLIEGRAGNAAFPSATLSLAGFMDDRLNRPAVDLEDEYGLMLRDGRYRDAAAGRTLDGPHRVDLFVRHAEKNMEAERCSTGEQKALLVGLVLAHAQLTANMTGYAPVLLLDEIAAHLDEGRRAALFDLIHALGGQSFMTGTDAAMFSALGERAQFFNVSHGGITA GT:EXON 1|1-375:0| SW:ID RECF_AGRT5 SW:DE RecName: Full=DNA replication and repair protein recF; SW:GN Name=recF; OrderedLocusNames=Atu0073; ORFNames=AGR_C_109; SW:KW ATP-binding; Complete proteome; Cytoplasm; DNA damage; DNA repair;DNA replication; DNA-binding; Nucleotide-binding; SOS response. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->375|RECF_AGRT5|0.0|100.0|375/376| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0009432|"GO:SOS response"|SOS response| PROS 126->146|PS00617|RECF_1|PDOC00539| PROS 317->335|PS00618|RECF_2|PDOC00539| SEG 137->153|sssdrrrfldrlvlsld| SEG 253->264|rdgryrdaaagr| BL:PDB:NREP 1 BL:PDB:REP 5->364|2o5vA|9e-16|30.9|327/358| RP:PDB:NREP 1 RP:PDB:REP 289->345|2bifA|2e-04|6.2|48/432| RP:PFM:NREP 1 RP:PFM:REP 7->108|PF02463|2e-05|34.4|96/536|SMC_N| HM:PFM:NREP 1 HM:PFM:REP 7->359|PF02463|5.8e-21|29.0|186/220|SMC_N| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF02463|IPR003395| GO:PFM GO:0005694|"GO:chromosome"|PF02463|IPR003395| RP:SCP:NREP 1 RP:SCP:REP 7->81,270->342|1f2t.1|9e-11|28.0|145/288|c.37.1.12| HM:SCP:REP 5->376|1w1wA_|1.5e-35|28.7|335/0|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 389 OP:NHOMOORG 389 OP:PATTERN -------------------------------------------------------------------- ----111-------111----1--11-----111-1----1------1----1-1-1-11--------1-----------------------------------1-----1111111111----1-----1-----1--11---1----------------------------------------1-----11---------------------1---111--11-------11--------------1--11-111111-111----111--111---11111111111111111111111111111111111111111111---------------11------1-11---1-----1--1-11----------111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-11111-----------------------------------------------------------------------1--------------111-1-1111-11-------------------------------11-111-1--11111111-11-1111111-----111------11111111111111111-111111111111111111111111---111111111111111111111111--111111111111-----------------1---111-11--111-----------111111111--111-1111-------------1-----------1--1---------------1111------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 354 STR:RPRED 94.4 SQ:SECSTR ####ccEEEEEEEccTTcccEEEEcccEEEEEEccTTccHHHHHHHHHHHHHccTTTcccGcccccGGccTTcccEEEEEEEEETEEEEETTccccEEEEEEEEEETTEEEcGGG##cccccEEEEcTTTTHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHTTcGTTTTHHHHHH####HcccccccccEEEEEEHHHHHHHHHHHHHTTccEEEEEHHHHHHHHHcccccGGGGcTTcHHHHHHHHHHHHHcccEHHHHHGGGTcccHHHcEHccccHHHHHHHHHHHHHGccccTTcHTTcEEEEEEEccccHHHHHHHHHHHHHHcGGEEEEEccccTTccEEEEEE########### DISOP:02AL 1-3,374-376| PSIPRED cccccEEEEEEEEcccEEHHEEEEccccEEEEEccccccHHHHHHHHHHHHcccccccccHHHHHHccccccEEEEEEEEcccccEEEEEEEEEccccEEEEEEEEccEEHHHHHHHHHHccEEEEcccHHHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccccHHHccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHccccEEEEcccEEcc //