[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85915.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y095_AGRT5   RecName: Full=UPF0133 protein Atu0095;

Homologs  Archaea  0/68 : Bacteria  508/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.222.1
:107 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->96 1j8bA PDBj 2e-10 50.8 %
:RPS:SCOP  37->96 1j8bA  d.222.1.1 * 1e-21 50.8 %
:HMM:SCOP  8->102 1pugA_ d.222.1.1 * 8.9e-31 53.8 %
:RPS:PFM   10->97 PF02575 * DUF149 1e-16 53.4 %
:HMM:PFM   8->100 PF02575 * DUF149 5.5e-35 52.7 93/93  
:BLT:SWISS 1->107 Y095_AGRT5 7e-57 100.0 %
:PROS 1->4|PS00228|TUBULIN_B_AUTOREG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85915.1 GT:GENE AAK85915.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(99146..99469) GB:FROM 99146 GB:TO 99469 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK85915.1 GB:DB_XREF GI:15154964 LENGTH 107 SQ:AASEQ MRDIMGMMGKVKEMQSKMEKVQQEIAALEIEGRAGGGLVTVILNGKGEMRGLKIDPSLFKEDEVEILEDLIVAAHKDAKEKGEAQAQEKMADLTAGLPLPPGMKLPF GT:EXON 1|1-107:0| SW:ID Y095_AGRT5 SW:DE RecName: Full=UPF0133 protein Atu0095; SW:GN OrderedLocusNames=Atu0095; ORFNames=AGR_C_145; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->107|Y095_AGRT5|7e-57|100.0|107/107| PROS 1->4|PS00228|TUBULIN_B_AUTOREG|PDOC00200| BL:PDB:NREP 1 BL:PDB:REP 28->96|1j8bA|2e-10|50.8|65/85| RP:PFM:NREP 1 RP:PFM:REP 10->97|PF02575|1e-16|53.4|88/93|DUF149| HM:PFM:NREP 1 HM:PFM:REP 8->100|PF02575|5.5e-35|52.7|93/93|DUF149| RP:SCP:NREP 1 RP:SCP:REP 37->96|1j8bA|1e-21|50.8|59/92|d.222.1.1| HM:SCP:REP 8->102|1pugA_|8.9e-31|53.8|91/94|d.222.1.1|1/1|YbaB-like| OP:NHOMO 511 OP:NHOMOORG 510 OP:PATTERN -------------------------------------------------------------------- -11--111---111----------------------11----11---------------------1-------------------1----------1---------111---------11----1--1-1-11--111111---111-11--11111-------111111-------------1-1--11-1-1111111111111111-1--111111--1--1--------------------------------------------------------------------------------------------------111------------1111-----1--1--1----1-----111111---11----1111111111111111111111111-1111-11-1111111111111111111111111111111111111111111111111111------------111111111111-11111111-1111111111111111111111111111111-1-111111111111111111111111111111111111111-111-111-11111------11211-11-11-------------------------111111-11111111111111111111111111-11111--111111111111111111111-1111111111111111111111111111111111111111111-1111111-1111111111111--1-1111111111-1-1111111111111111111111-11-11111111-1111111111111111-111111-111111111111111111111111-1--111111------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 90.7 SQ:SECSTR #####cHHHHHHHHcccccHHHHHHHHcEEEEEEGGGTEEEEEETTccEEEEEEcGGGHHGccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccTccccc##### DISOP:02AL 1-17, 81-97| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEccccEEEEEEEcccEEEEEEEcHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //