[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85924.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  156/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.116.1
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->150 2z0kA PDBj 7e-15 34.1 %
:RPS:PDB   1->152 2cx5A PDBj 1e-32 30.9 %
:RPS:SCOP  4->152 1wdvA  d.116.1.1 * 9e-32 30.9 %
:HMM:SCOP  4->153 1dbxA_ d.116.1.1 * 2.4e-37 39.3 %
:RPS:PFM   25->135 PF04073 * YbaK 1e-14 39.1 %
:HMM:PFM   26->140 PF04073 * YbaK 6.5e-31 37.4 115/123  
:BLT:SWISS 1->152 YWHH_BACSU 6e-33 46.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85924.1 GT:GENE AAK85924.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(108895..109353) GB:FROM 108895 GB:TO 109353 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK85924.1 GB:DB_XREF GI:15154975 LENGTH 152 SQ:AASEQ MSIESVRAFFIEKSPGVTVIETEGSSATVALAAEAHGVDPDQIAKTICLKAGDTILLVVAAGTRRLDNRKFRDHFGAKPRMLGAEEVVAVTSHPIGGVCPFGLPSALPVFCDISLKNYQEVVPAAGATNAAVKISPDVMVELTGAEWVDVCQ GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 1->152|YWHH_BACSU|6e-33|46.1|152/157| BL:PDB:NREP 1 BL:PDB:REP 19->150|2z0kA|7e-15|34.1|132/156| RP:PDB:NREP 1 RP:PDB:REP 1->152|2cx5A|1e-32|30.9|152/157| RP:PFM:NREP 1 RP:PFM:REP 25->135|PF04073|1e-14|39.1|110/122|YbaK| HM:PFM:NREP 1 HM:PFM:REP 26->140|PF04073|6.5e-31|37.4|115/123|YbaK| RP:SCP:NREP 1 RP:SCP:REP 4->152|1wdvA|9e-32|30.9|149/150|d.116.1.1| HM:SCP:REP 4->153|1dbxA_|2.4e-37|39.3|150/157|d.116.1.1|1/1|YbaK/ProRS associated domain| OP:NHOMO 166 OP:NHOMOORG 159 OP:PATTERN -------------------------------------------------------------------- ----1---------1---------------------1-11-------1----1---------1-----1-----------1----------------------------------------------------------------1----------------------------------------11--1-----------------------1------1---------1------------------------1--1--------------1-------------------------------------------------11--1111-11----111----------1-1-11-111-11-111--1---------------111---1111111111111111---1--1-1-1---111111111111--------------11111111-11-1--1--------------------------------1-1-11-1-------1111----2222121-1-111--111--1-1--1-1---1-1--1----------------------1--11--1-1------------------------------------------------------------------------------------11---1-------------------------------111-----1111111111111111-------------------------------------------------------------------1121----1---------------------------1---------------------1--------------1---------------------------------------- --------21---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHTTcTTccEEEccTTcccHHHHHHHHTccGGGEEEEEEEEccccEEEEEEETTccccHHHHHHHHTcccEEccHHHHHHHHcccTTccccccccccccEEEEGGGGGcccEEEEcccTTEEEEEcHHHHHHHHccEEEcccc DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHcccHHHEEEEEEEEEcccEEEEEEcccccccHHHHHHHHccccccccHHHHHHHHcccccccccccccccccEEEEHHHHccccEEEEccccccEEEEcHHHHHHHcccEEEEEcc //