[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85930.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:136 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   48->68 PF06842 * DUF1242 0.00012 42.9 21/36  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85930.1 GT:GENE AAK85930.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(112724..113134) GB:FROM 112724 GB:TO 113134 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK85930.1 GB:DB_XREF GI:15154981 LENGTH 136 SQ:AASEQ MSKVSIFKAYFGAVFLTAIIAIAAWWQGDNATTIFHKALVVPLYLLASTGLRSYFPEIFDSKRGILGTLEFHILNSAILAAFFILVLRPFPDDIGNQLVSFFFLIAFTGTANFARAMHARKKNQYSDQTSPHLTDL GT:EXON 1|1-136:0| TM:NTM 4 TM:REGION 4->25| TM:REGION 31->53| TM:REGION 64->86| TM:REGION 93->115| HM:PFM:NREP 1 HM:PFM:REP 48->68|PF06842|0.00012|42.9|21/36|DUF1242| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 119-131, 133-136| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccc //