[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85937.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   12->143 PF07331 * DUF1468 3e-13 34.1 %
:HMM:PFM   6->148 PF07331 * DUF1468 4.5e-63 53.1 143/144  
:BLT:SWISS 32->149 YTZ1_AGRVI 2e-09 27.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85937.1 GT:GENE AAK85937.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 122012..122473 GB:FROM 122012 GB:TO 122473 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK85937.1 GB:DB_XREF GI:15154990 LENGTH 153 SQ:AASEQ MKSLFNDPAEAICGAIFMGLGVFFALQSYGLEIGTAFRMGPGYFPLVLAIILILLGGIIFLRSARPAGEGIGAIAWRGIFFILPAPIFFGFTVRGLGFVPALFFSALIASFASHKMSPLMAVILSAAITVFSVAVFNYGLGLPFQRFGPWLKF GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 32->149|YTZ1_AGRVI|2e-09|27.1|118/155| TM:NTM 5 TM:REGION 8->30| TM:REGION 41->63| TM:REGION 67->89| TM:REGION 93->115| TM:REGION 118->140| SEG 46->59|lvlaiilillggii| SEG 101->113|alffsaliasfas| RP:PFM:NREP 1 RP:PFM:REP 12->143|PF07331|3e-13|34.1|132/142|DUF1468| HM:PFM:NREP 1 HM:PFM:REP 6->148|PF07331|4.5e-63|53.1|143/144|DUF1468| OP:NHOMO 18 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1----11-1121111111-----1----------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHccccccc //