[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85947.2
DDBJ      :             membrane lipoprotein
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  338/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:330 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->293 2fqwA PDBj 3e-30 34.3 %
:RPS:PDB   70->268 3brqA PDBj 5e-11 11.6 %
:RPS:SCOP  70->281 1bdhA2  c.93.1.1 * 2e-10 14.5 %
:HMM:SCOP  25->281 1rpjA_ c.93.1.1 * 2.1e-14 22.7 %
:RPS:PFM   26->288 PF02608 * Bmp 2e-50 47.1 %
:HMM:PFM   31->304 PF02608 * Bmp 1.3e-63 37.7 268/306  
:BLT:SWISS 23->287 Y1714_PYRHO 8e-35 36.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85947.2 GT:GENE AAK85947.2 GT:PRODUCT membrane lipoprotein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 129978..130970 GB:FROM 129978 GB:TO 130970 GB:DIRECTION + GB:PRODUCT membrane lipoprotein GB:PROTEIN_ID AAK85947.2 GB:DB_XREF GI:159139504 LENGTH 330 SQ:AASEQ MKKSLLTLFALAAMSASALAADIKPALVYGTGGKFDKSFNEAAAAGAEKFKAETGIDFRDFEPTSDTQGEQAIRNFASKGFNPVVAVSFAWTSAMEKVAAEFPDTKFVIVDSVVELPNVRSVVYKEHEGSYLVGLLAGMASKTGKVGFIGGMDIPLIRKFACGYAQGAKAANDKIEVFQNMTGTTGAAWNDPVRGGELTKNQIDQGADVIYAAAGATGIGVLQTAADNKKFSIGVDSNQNHLHPGSVLTSMVKRVDLAVYNAYKDAKDDKFTPGIVALGVKEDGVAYALDDNNKALITPEMTAAVDKAKADIIAGTVKVHDYMADNSCPK GT:EXON 1|1-330:0| BL:SWS:NREP 1 BL:SWS:REP 23->287|Y1714_PYRHO|8e-35|36.0|261/405| SEG 4->21|slltlfalaamsasalaa| SEG 41->53|eaaaagaekfkae| SEG 303->314|aavdkakadiia| BL:PDB:NREP 1 BL:PDB:REP 22->293|2fqwA|3e-30|34.3|268/316| RP:PDB:NREP 1 RP:PDB:REP 70->268|3brqA|5e-11|11.6|190/262| RP:PFM:NREP 1 RP:PFM:REP 26->288|PF02608|2e-50|47.1|259/288|Bmp| HM:PFM:NREP 1 HM:PFM:REP 31->304|PF02608|1.3e-63|37.7|268/306|Bmp| GO:PFM:NREP 1 GO:PFM GO:0008289|"GO:lipid binding"|PF02608|IPR003760| RP:SCP:NREP 1 RP:SCP:REP 70->281|1bdhA2|2e-10|14.5|207/282|c.93.1.1| HM:SCP:REP 25->281|1rpjA_|2.1e-14|22.7|247/288|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 604 OP:NHOMOORG 365 OP:PATTERN 111-11------------11122132221-1-------------1---------1111111---1--- --1-1---------------------------------1-----211-1221-1111---1121111321--------1---1------------------------------------------1111111111111111---1--1-----11------------1121------------3212211-133111111111111111111132111211223211111133--------------------22-3--3-111---------2211112223111111111111111112222222222222111111111211212111111111222--2222311111--1-11-2--111111111-12-------------222---1-11-22212121223-11211-2-25--3223434555551----3323333222---------11---13-----------------------------------1---1-------------52--------31211--111522-2321243-2-----2------------1-1-2-11221-4111--------1-111112-1---------------------------1-2-1-----1-------1------2--1----------------------------------------------------------------------------------------------------------------3-2---------------------1----11111-11-----12323-----------------------------------------4------64455454221-------------------------1542214111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 272 STR:RPRED 82.4 SQ:SECSTR #####################ccEEEEEEccccTTcccHHHHHHHHHHHHHHHHTcEEEEEEcccTTHHHHHHHHHHHTTccEEEEcccccHHHHHHHHHTccccccEEEcccccccGGGEEcccHHHHHHHHHHHHHHHTTcccEEEEcccTcHHHHHHHHHHHHHHHTTTccccGGGEEccccccTTcccHHHHHHHHHHHTccccEEEEccHHHHHHHHHHHHTccTTTEEEcccTTGGGcccccEEEEccHHHHHHHHHHHHHTccccTTcEETTTEEcEEEcccccTT##################################### DISOP:02AL 1-1,17-17,323-331| PSIPRED cHHHHHHHHHHHHcccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHccccEEEEEEcccccccEEEEEEEccHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHcccEEEEEccHHHHHccccEEEEEEEcHHHHHHHHHHHHHcccccccEEEEEEccccEEEEEccccHHHccHHHHHHHHHHHHHHHcccEEEccccccccccc //