[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85950.1
DDBJ      :             ABC transporter, membrane spanning protein (sugar/ribonucleotide)
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  343/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:323 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   35->248 PF02653 * BPD_transp_2 1e-10 34.5 %
:HMM:PFM   13->298 PF02653 * BPD_transp_2 2e-42 28.0 254/267  
:HMM:PFM   292->309 PF09574 * DUF2374 0.00069 64.3 14/42  
:BLT:SWISS 1->321 YUFQ_BACSU 4e-46 37.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85950.1 GT:GENE AAK85950.1 GT:PRODUCT ABC transporter, membrane spanning protein (sugar/ribonucleotide) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 133676..134647 GB:FROM 133676 GB:TO 134647 GB:DIRECTION + GB:PRODUCT ABC transporter, membrane spanning protein (sugar/ribonucleotide) GB:PROTEIN_ID AAK85950.1 GB:DB_XREF GI:15155005 LENGTH 323 SQ:AASEQ MDFFDMLVSILGSTVRLTIPLLFTALAGLFSERAGVFDIGLEGKMLAAAFASACVAYLTANPWAGLLAGIGVSILFSLIHGFAVITNRGNQIVSGVALNFIAAGLTVVLGQAWFGQGGRTPQLPGEGRFAPIILPGADAMREVPFIGPLYANVISGNNILTYLAFLAVPLSWWVLYRTRFGLRLRAVGENPGAVDTAGISVTWMRYRAVIVAGFLCGFSGAYLAVAQSAAFIANMSAGKGYIALAALIFAKWKPVPVMFACLLFGFLDAFANFMQGKSVPGIGEVPVQIFQAMPYILTCILLAGFIGVAKPPKAGGVAYAKER GT:EXON 1|1-323:0| BL:SWS:NREP 1 BL:SWS:REP 1->321|YUFQ_BACSU|4e-46|37.2|309/319| TM:NTM 7 TM:REGION 5->27| TM:REGION 36->58| TM:REGION 65->87| TM:REGION 92->114| TM:REGION 217->239| TM:REGION 255->277| TM:REGION 284->306| RP:PFM:NREP 1 RP:PFM:REP 35->248|PF02653|1e-10|34.5|197/271|BPD_transp_2| HM:PFM:NREP 2 HM:PFM:REP 13->298|PF02653|2e-42|28.0|254/267|BPD_transp_2| HM:PFM:REP 292->309|PF09574|0.00069|64.3|14/42|DUF2374| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF02653|IPR001851| GO:PFM GO:0006810|"GO:transport"|PF02653|IPR001851| GO:PFM GO:0016020|"GO:membrane"|PF02653|IPR001851| OP:NHOMO 610 OP:NHOMOORG 370 OP:PATTERN 221-11------------22131131111-1-----------------------1112121---2--- --1-1---------------------------------1-----21111112211-11--1152221312--------2---2------------------------------------------2111212112123322---22-1-----12------------2211------------11-1122-111--1-111111112211---11111111121111111124--------------------11-1--1--1----------11211122211-111211111211111111111111111111122211111132222222222233---3222512111--1111-3-1122122212-12-------------222---1-1--22222222223-1121--2-26--5225545556661----4323333233---------11---12-----------------------------------1-----------------41--------21211--111421-1111233-2-----1------------1-2-3-1122--1111----------111113-1---------------------------223-------1-------2------2--2----------------------------------------------------------------------------------------------------------------3-3---------------------1----11111-11-----12244-----------------------------------------1------11111111212----1-1111111111111-11---1521225222--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 321-323| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHcccccccccHHHccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHccccccccc //