[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85964.1
DDBJ      :             MFS permease
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  448/915 : Eukaryota  9/199 : Viruses  1/175   --->[See Alignment]
f.38.1
:440 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->432 1pw4A_ f.38.1.1 * 1.2e-38 24.1 %
:HMM:PFM   55->250 PF00083 * Sugar_tr 1.2e-16 22.7 185/451  
:HMM:PFM   293->423 PF00083 * Sugar_tr 4.3e-05 20.0 130/451  
:BLT:SWISS 27->429 YHJE_ECOLI 2e-51 38.5 %
:PROS 310->327|PS00216|SUGAR_TRANSPORT_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85964.1 GT:GENE AAK85964.1 GT:PRODUCT MFS permease GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 147053..148375 GB:FROM 147053 GB:TO 148375 GB:DIRECTION + GB:PRODUCT MFS permease GB:PROTEIN_ID AAK85964.1 GB:DB_XREF GI:15155021 LENGTH 440 SQ:AASEQ MSYTNAAPSFGQAPEANGAGPTSVDPDRITIAVILARMTEFFDFFIYAIASALVFPHVFFSFVDPLTATLYSFAVFSLAFIARPIGSLIFLQIDRKFGRAVKLMAALFTLCGSTMAISFLPSYDEAGMLAPCLLAAFRIGQGLGLGGAWDGLVSLLAMNAPQKQRGWYAMMPQIGAAMGFGLASAFFIVFVTQLSNAEFLAWGWRFPFFVALALNVLALFARLRMIVTPEFQAMLEQHELEPRPMFRMLRSQFPVVLTGAFVPLASFALFHLVTVFPLSWVSLNTSQRVSDFLFVQFVSAIICGGMIVVSGILADRIGRRKLLAIAAALIGLFSLVAPVLLSSGDIGRYLFVLIGFSLLGLSFGQAGGALASRFSREYRYTGASLTSDISWLIGAGFAPLVALGFSSKFGLFAVGIYLMSGAVCTLVALWFSRTLEMPSE GT:EXON 1|1-440:0| BL:SWS:NREP 1 BL:SWS:REP 27->429|YHJE_ECOLI|2e-51|38.5|403/440| PROS 310->327|PS00216|SUGAR_TRANSPORT_1|PDOC00190| TM:NTM 12 TM:REGION 43->65| TM:REGION 71->93| TM:REGION 100->122| TM:REGION 139->160| TM:REGION 170->192| TM:REGION 201->222| TM:REGION 256->278| TM:REGION 288->310| TM:REGION 322->344| TM:REGION 346->368| TM:REGION 386->407| TM:REGION 413->435| SEG 140->152|gqglglggawdgl| SEG 206->221|fpffvalalnvlalfa| SEG 316->332|rigrrkllaiaaaligl| SEG 350->372|lfvligfsllglsfgqaggalas| HM:PFM:NREP 2 HM:PFM:REP 55->250|PF00083|1.2e-16|22.7|185/451|Sugar_tr| HM:PFM:REP 293->423|PF00083|4.3e-05|20.0|130/451|Sugar_tr| HM:SCP:REP 1->432|1pw4A_|1.2e-38|24.1|403/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 2169 OP:NHOMOORG 475 OP:PATTERN ------1613333361-213322---------------------------------------1----- -1--131455B-2143222-27--1T2222215999DMkn--124-1--44-PIL523-----228M65311111222-12-8--111-----------1-2---1-1-1-----------------1-1---1-------11111--------------121---------1-----1-----1--------1222222211222222------222-13--1-------1-111111111111111--112----11-1-----11-----1---------------------------------------------------------------------------------------------------1--44451442442C441-32323244444443434-55943D67121-566522233433A3-----5-----1-32333333223-11-13313344411--23463252242241-12-1364-63345OIIOKK89BB8OOUGDGDC8FPFS9EA6-5EB832422611-7336---1121-------11--1-1--1----21--------------1111-1-----1-544533---11-------------1---------------1--------------1---------6666-754668577755-665567555667555455668665--15545455555445455732533341-2---------------11111455611-1--------22211--177778571-24-99A8ACC71ACBD-978444335444---------------33424223331111---------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------3------------------------------------------------------3------------11-----1----2---12----1 --------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- DISOP:02AL 1-25, 238-239, 436-440| PSIPRED ccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccc //