[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85968.2
DDBJ      :             Atu0148-1 mutant of a conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:198 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   19->61 PF07811 * TadE 3e-04 39.5 %
:HMM:PFM   19->58 PF07811 * TadE 1.6e-10 30.0 40/43  
:BLT:SWISS 7->60 NCED2_ARATH 7e-04 40.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85968.2 GT:GENE AAK85968.2 GT:PRODUCT Atu0148-1 mutant of a conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(156680..157276) GB:FROM 156680 GB:TO 157276 GB:DIRECTION - GB:PRODUCT Atu0148-1 mutant of a conserved hypothetical protein GB:PROTEIN_ID AAK85968.2 GB:DB_XREF GI:159139514 LENGTH 198 SQ:AASEQ MRLARLKPLLEKFGFSRDGTAAIEFAILAIPYFLVVFAIIETFIALMAEQVVANATETMSRRLRTGQISSSITKEDFRRSFCNEVSVMIACSEDEIKKEEKLYVDLRSFTAFKDIPTTIPLKAYGEYYDLDTAQFGFKPGGPETINMLRVYYRWRVVADIIRPYLTKIRPADGSMPSHFLIVATSAFMSEKYITGGGA GT:EXON 1|1-198:0| BL:SWS:NREP 1 BL:SWS:REP 7->60|NCED2_ARATH|7e-04|40.7|54/583| TM:NTM 1 TM:REGION 21->43| RP:PFM:NREP 1 RP:PFM:REP 19->61|PF07811|3e-04|39.5|43/43|TadE| HM:PFM:NREP 1 HM:PFM:REP 19->58|PF07811|1.6e-10|30.0|40/43|TadE| OP:NHOMO 37 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---------11-112-1-1----------1---------1-11211122122111--111------------------1----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,195-195,197-199| PSIPRED cccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHEEEHHHccccccccccccccccccEEEEccccccccccccccEEEEEEEEEccHHccccccHHcccccccccccccEEEEEEHHHccccccccccc //