[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85973.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85973.2 GT:GENE AAK85973.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 160159..160416 GB:FROM 160159 GB:TO 160416 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK85973.2 GB:DB_XREF GI:159139518 LENGTH 85 SQ:AASEQ MQGQRPLRPHSLSSEPSLQKSLPQYAVRIQEPSGWNQRKFAGIAGLQPFATLGDAETIESIPCKRYMLLQLTGFISLFGTGLHGI GT:EXON 1|1-85:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-20| PSIPRED cccccccccccccccHHHHHcccHHEEEEEcccccccHHHcccccccHHHHcccHHHHHccccHHHHHHHHHHHHHHHHHHHccc //