[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85977.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:236 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   134->191 2b5fD PDBj 4e-05 24.1 %
:RPS:PFM   25->153 PF06912 * DUF1275 2e-04 34.9 %
:HMM:PFM   21->213 PF06912 * DUF1275 3.7e-38 34.2 193/209  
:BLT:SWISS 21->191 Y4105_RHIME 5e-37 48.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85977.2 GT:GENE AAK85977.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(162149..162859) GB:FROM 162149 GB:TO 162859 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK85977.2 GB:DB_XREF GI:159139521 LENGTH 236 SQ:AASEQ MTRQRRRNIIRARRTGTGIALVAAISFIAGMTDAVGLHLSGDFVSFMTGNTTRAAISLEAGVYSHAAKLLFAIVAFVAGNAGGIVVAHKFDRSILAVLVGVGLLVAIAALLRGDAFALTQFYLVVFAMGMVNAAVEHIEGLPIGLTYVTGALSRFGRGIGRFLLGERSLDWGIQIVPWLGMISGAICGAVLGVTLQSGALWVVAATVFAVAVATLVIPRSLRHRYNQRVRIRRIAP GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 21->191|Y4105_RHIME|5e-37|48.5|167/225| TM:NTM 5 TM:REGION 22->44| TM:REGION 67->89| TM:REGION 102->124| TM:REGION 170->192| TM:REGION 199->221| SEG 2->20|trqrrrniirarrtgtgia| SEG 94->111|ilavlvgvgllvaiaall| SEG 154->167|rfgrgigrfllger| SEG 199->216|alwvvaatvfavavatlv| RP:PDB:NREP 1 RP:PDB:REP 134->191|2b5fD|4e-05|24.1|58/230| RP:PFM:NREP 1 RP:PFM:REP 25->153|PF06912|2e-04|34.9|129/210|DUF1275| HM:PFM:NREP 1 HM:PFM:REP 21->213|PF06912|3.7e-38|34.2|193/209|DUF1275| OP:NHOMO 28 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1-------------------1-----111-11-111-2---------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-11---111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 24.6 SQ:SECSTR #####################################################################################################################################cccEEccHHHHHHHHTcccccHHHHHHHHHHHccHHHHHHTTHHHHHHHHHHHHHHHH############################################# DISOP:02AL 1-16,235-237| PSIPRED ccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHcccHHEEEEEccc //