[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85978.1
DDBJ      :             ABC transporter, substrate binding protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  262/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.19c.94.1
:333 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   58->204 3e4rA PDBj 4e-09 31.9 %
:RPS:PDB   45->333 2de3B PDBj 2e-25 15.4 %
:RPS:SCOP  21->322 1dioA  c.1.19.3 * 2e-19 8.2 %
:HMM:SCOP  41->263 1xs5A_ c.94.1.1 * 4e-39 30.4 %
:RPS:PFM   69->258 PF09084 * NMT1 3e-11 30.9 %
:HMM:PFM   53->261 PF09084 * NMT1 2.2e-23 22.7 207/216  
:BLT:SWISS 22->322 Y4186_BRUSU 1e-13 24.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85978.1 GT:GENE AAK85978.1 GT:PRODUCT ABC transporter, substrate binding protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 163006..164007 GB:FROM 163006 GB:TO 164007 GB:DIRECTION + GB:PRODUCT ABC transporter, substrate binding protein GB:PROTEIN_ID AAK85978.1 GB:DB_XREF GI:15155039 LENGTH 333 SQ:AASEQ MPQIKRKKYRTKINQKGVPIMKRTWVIAAIATLVSSASAYAETAVTIGMSGWTGFAPLTLAKQAGIFEKNGLKVDIKKIPQASRHLALASGDIQCAATTVETWIAWNANGVKSTQIFQMDKSHGADGIAVRSDVSKVADLKGKTVAASAPGTSPYFFLAWILKENGLTLKDVKVVNLEPGPAAQAFVAGQNDAAMTYEPYLSTVRAAPDKGKILATTLDYPAVMDTFGCTPDFLKANPQAAKALADSYFQALELIKADPEKSYATMGADVKQAGEAFAASAKFLEWQDKAANQKFFEGEFKTFSEKSADLLLEIGVIKSKPDLSTLADTSFIK GT:EXON 1|1-333:0| BL:SWS:NREP 1 BL:SWS:REP 22->322|Y4186_BRUSU|1e-13|24.4|295/319| BL:PDB:NREP 1 BL:PDB:REP 58->204|3e4rA|4e-09|31.9|144/291| RP:PDB:NREP 1 RP:PDB:REP 45->333|2de3B|2e-25|15.4|285/347| RP:PFM:NREP 1 RP:PFM:REP 69->258|PF09084|3e-11|30.9|188/200|NMT1| HM:PFM:NREP 1 HM:PFM:REP 53->261|PF09084|2.2e-23|22.7|207/216|NMT1| RP:SCP:NREP 1 RP:SCP:REP 21->322|1dioA|2e-19|8.2|294/551|c.1.19.3| HM:SCP:REP 41->263|1xs5A_|4e-39|30.4|214/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 397 OP:NHOMOORG 266 OP:PATTERN --------------------------------11-------------1-------------------- --1-1---------111--------2------1----1------11---11---------------11-----------------1----------------------------------------------------------1-1-11--1----1-1--111-22-------------------------211111-1111211112----121-1-1-----------2------------------------11---------11----1----------------------------------------------------1--------------------1-------32-------2-------1--111-------4348--12121-11111111112-1-3-1212122-5224211313--33-----1-------111111111---1----------------------------------1---1212--2222-1111122542222-21241311--3321-2--223233-2--2-11-----------211-----1----1----12--1-1-------2-1---------------------1-1-----1-12----11-----------1----11-----12------1-11-11111111-111-111111111111111111113133-------------------11111111--1111--1-1-----------------11-1---------------33323-1---211111--42311--3223---------2------------------------------11------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 313 STR:RPRED 94.0 SQ:SECSTR ####################HHTTccHHHHHHHHHHHHHTTcEcEEEEEEEcccccHHHHHHHTTHHHHTTEEEEEccGGGTTHHHcccTTEEEEEccHHHHHHHHTTcTTccEEEEEEEEEcccEEEEEccccccGGGGTTcEEEEcHHHHHHHHTccTTHHHTTccGGGcEEEEcccTTTcHHHHHTcccEEEEEHHHHHHHHTTTcEEcccGGGcGGGcEEEEEEEEHHHHHHcHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHTccHHHHHHHHHHHcTTGGGcccccccHHHHHHHHHHHHHHHHTTcccccccHHHHccHHHHH DISOP:02AL 1-15| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEccccHHHHHHHHHHcHHHHcccEEEEEEcccHHHHHHHHcccEEEEEccHHHHHHHHHccccEEEEEEEEccccEEEEEEccccccHHHHcccEEEEEccccHHHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHcccEEEEEEccHHHHHHHHHcccEEEEEEcccccccccEEEEEHHHHHHcHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHHcccccHHcccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcc //