[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK85986.1
DDBJ      :             transcriptional regulator, AraC family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  163/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.24.16a.4.1
:346 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   238->345 1bl0A PDBj 2e-15 19.6 %
:RPS:SCOP  222->341 1v4aA1  a.24.16.4 * 1e-12 13.3 %
:HMM:SCOP  290->340 1d5yA2 a.4.1.8 * 3.1e-10 37.3 %
:RPS:PFM   299->337 PF00165 * HTH_AraC 1e-04 35.9 %
:HMM:PFM   302->338 PF00165 * HTH_AraC 4.9e-08 33.3 36/42  
:HMM:PFM   243->293 PF09312 * SurA_N 0.00022 33.3 51/118  
:BLT:SWISS 24->339 Y1430_MYCBO 2e-19 23.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85986.1 GT:GENE AAK85986.1 GT:PRODUCT transcriptional regulator, AraC family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(171256..172296) GB:FROM 171256 GB:TO 172296 GB:DIRECTION - GB:PRODUCT transcriptional regulator, AraC family GB:PROTEIN_ID AAK85986.1 GB:DB_XREF GI:15155049 LENGTH 346 SQ:AASEQ MPEKRVSDEISVVAGLAAGVSNYARSRGIDIVPICKALDIDPATFSSLTERISLDRFSRLLETCALISGDDAFGLQCAATFPAGASGAFGYGLISAPTVRSFLRFLQDHVYYATNNSNFTMVADATQVTLSWSFAPGIAKRDQYVDLSLAVLVQRLRDILGERVNQIEIGLERQKPINIQLFKERLTRRVSFSQAIHTMRLPASLLDVANPNADERLFELMNLQCRMLRPETSADPTHFIDQVKRYMQMRLSDAELSLGEIAPYFNLSERSFQRRLAELGTNLNEIKDAIRKNAGFKLLVESDLPVSDISYRLGYSTPGAFSRSVSRWFGATPTDIRRKHAHHSAG GT:EXON 1|1-346:0| BL:SWS:NREP 1 BL:SWS:REP 24->339|Y1430_MYCBO|2e-19|23.3|313/344| RP:PDB:NREP 1 RP:PDB:REP 238->345|1bl0A|2e-15|19.6|107/116| RP:PFM:NREP 1 RP:PFM:REP 299->337|PF00165|1e-04|35.9|39/40|HTH_AraC| HM:PFM:NREP 2 HM:PFM:REP 302->338|PF00165|4.9e-08|33.3|36/42|HTH_AraC| HM:PFM:REP 243->293|PF09312|0.00022|33.3|51/118|SurA_N| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00165|IPR000005| GO:PFM GO:0005622|"GO:intracellular"|PF00165|IPR000005| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00165|IPR000005| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00165|IPR000005| RP:SCP:NREP 1 RP:SCP:REP 222->341|1v4aA1|1e-12|13.3|120/151|a.24.16.4| HM:SCP:REP 290->340|1d5yA2|3.1e-10|37.3|51/0|a.4.1.8|1/1|Homeodomain-like| OP:NHOMO 455 OP:NHOMOORG 165 OP:PATTERN -------------------------------------------------------------------- --------------3--22-21--1-22222-----2222------------------------1-1-----------------------1-------------21-2-----------------------------------------3-----------------------------------------------------------1----------1-----------1-------------------------------11----------1------------------------------------------------------------------------------------------------1-----------2-123-----11-------------3-33-8---11-11111--21--111-1---2----12211111111-------1-------------------------------1--1-----455654322228832434523B6-8C78--112----12--123--2----------------1-1-2-1------------------------15-----------------------1---------A22-12-1------1222--12--23---------------11--1---------------------------------12--------------------------------------------------1111-98-1---------------7778844---1-65355883B36442211----------1---------1---------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 37.9 SQ:SECSTR ######################################################################################################################################################################################################################cHHHHHTTTTcGGGccTTccTTcHHHHHHHHHHHTTTTcHccccHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHcccHHHHHTccccccT# DISOP:02AL 1-4, 227-237, 336-346| PSIPRED ccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHccccccccHHHHHHHHHHHHHHccccccHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccEEEEEEEccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHcccccHHHEEEcccccccHHHHHHHHcccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHcccccc //