[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86009.2
DDBJ      :             ABC transporter, membrane spanning protein (peptide)
Swiss-Prot:             

Homologs  Archaea  54/68 : Bacteria  752/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:381 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   273->314 3dhwA PDBj 5e-09 34.3 %
:RPS:SCOP  155->374 2r6gG1  f.58.1.1 * 1e-23 9.5 %
:RPS:PFM   248->336 PF00528 * BPD_transp_1 6e-06 31.0 %
:HMM:PFM   197->378 PF00528 * BPD_transp_1 7.1e-33 28.5 172/185  
:BLT:SWISS 21->378 YEJE_ECOLI 8e-92 51.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86009.2 GT:GENE AAK86009.2 GT:PRODUCT ABC transporter, membrane spanning protein (peptide) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 192608..193753 GB:FROM 192608 GB:TO 193753 GB:DIRECTION + GB:PRODUCT ABC transporter, membrane spanning protein (peptide) GB:PROTEIN_ID AAK86009.2 GB:DB_XREF GI:159139532 LENGTH 381 SQ:AASEQ MSLAQPAGTETLVKPKRPWFSPTTKRRWQNFKANRRGYWSFWLFLILFFLSLIAEFIANDKPILASYKGEILVPVMVDYPEEKFGGFLAQTDYKSSFIQDEINANGWMIWPPIRYSYQTVNSNIPHSAPTAPFWLMDEKERCSAYPQGNADPGCTLGNLNWLGTDNQARDVTARMIYGFRISVLFGLTLTIASALVGVTAGAIQGYFGGWTDLLLQRFIEIWSSMPVLYILLIIAAILPPGFFVLLGIMLLFSWVGFVGIVRAEFLRARNFEYVRAARALGVGNWTIMFRHLLPNAMVATLTFLPFILSGSITTLTSLDFLGFGMPPGSPSLGEMIAQGKNNLQAPWLGLTAFFTMSIMLSLLIFVGEAVRDAFDPRKTFR GT:EXON 1|1-381:0| BL:SWS:NREP 1 BL:SWS:REP 21->378|YEJE_ECOLI|8e-92|51.5|334/341| TM:NTM 5 TM:REGION 41->63| TM:REGION 175->197| TM:REGION 234->256| TM:REGION 292->314| TM:REGION 347->369| SEG 39->53|wsfwlflilfflsli| SEG 228->238|lyilliiaail| RP:PDB:NREP 1 RP:PDB:REP 273->314|3dhwA|5e-09|34.3|35/203| RP:PFM:NREP 1 RP:PFM:REP 248->336|PF00528|6e-06|31.0|84/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 197->378|PF00528|7.1e-33|28.5|172/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 155->374|2r6gG1|1e-23|9.5|220/284|f.58.1.1| OP:NHOMO 3172 OP:NHOMOORG 812 OP:PATTERN 44313131222232112333321132243142-1---1-----113-52-C94-544311211-3-11 1114B353233-4113322-2211292222224333257715274A64335158532211442275567832222611323-411111--------2--------11--122222222222222211111111121344852216933213321222------32115222--1-------1-A5433661423666664565546445A76663655324C521222222E6155555555655556333122222331-12111--33111112234333333311112211111112222222222222231112211111C25244434531422222111153123A-111A963--282-2151164211----111-131FFN115644A199A99897AAK-44B4392CMM1-jPPWIGDVSJNOK4-114ADA6AA6AC--------122-2219----------------------------------1BDA9C57777544444558855552566C64A7113342343343C5CO241132242-------111211345122352233331111111211----1211--11-------22212221112-12--5621211111411111-1111111111111--13111------66JB2866666665666-6666666666666666665ABAB92245555555555545455866556463-433333343333---11-1-1111111747222-12222213122222221212322332334462644429A91----1---254456666656677--1-------------12111111111111116-1-11-1-111111-111112-1111132643ADA77212 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2------1--1---1-------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 35 STR:RPRED 9.2 SQ:SECSTR ################################################################################################################################################################################################################################################################################TTTHHHHHTccTHHHHHHTTHHHH#######HHHHHHHHHHH################################################################### DISOP:02AL 1-19,379-382| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccEEEEEEcccccHHHcccccccccccHHHHHHHccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccc //