[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86018.1
DDBJ      :             ABC transporter, substrate binding protein (proline/glycine/betaine)
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  378/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->303 1sw4A PDBj 1e-20 27.0 %
:RPS:SCOP  30->303 1sw1A  c.94.1.1 * 9e-77 27.0 %
:HMM:SCOP  23->303 1sw5A_ c.94.1.1 * 2.1e-54 33.7 %
:RPS:PFM   33->296 PF04069 * OpuAC 5e-20 36.7 %
:HMM:PFM   24->298 PF04069 * OpuAC 1.8e-59 32.7 248/257  
:BLT:SWISS 30->303 OSMF_ECOLI 4e-83 52.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86018.1 GT:GENE AAK86018.1 GT:PRODUCT ABC transporter, substrate binding protein (proline/glycine/betaine) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(203203..204114) GB:FROM 203203 GB:TO 204114 GB:DIRECTION - GB:PRODUCT ABC transporter, substrate binding protein (proline/glycine/betaine) GB:PROTEIN_ID AAK86018.1 GB:DB_XREF GI:15155085 LENGTH 303 SQ:AASEQ MNRLMTLTGAGLALAFSVSIAQAQVVVSSKIDTEGGVLGNIILAVLNQNKIETTDRIQLGATPVVRKAITAGEIDIYPEYTGNAAFFFSKADDPLWKDAAKGYEEAKTLDYDANKIVWLAPSPANNTWAIALRKDVADKNNLKTLSDFGKYVAGGGTVVLAASSEFVNSAAALPAFQTTYGFTMKPDQLITLSGGDTAATIAAAANQTNNANAAMVYGTDGGIAPSGLVVLEDDKHVQPVYQPAPIIREEVLKKHPNIEELLKPVFEKLDLATLQDLNARVQVGGEQAKTVAMDFLTKNGFAK GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 30->303|OSMF_ECOLI|4e-83|52.6|274/305| SEG 6->15|tltgaglala| SEG 17->29|svsiaqaqvvvss| SEG 197->214|taatiaaaanqtnnanaa| BL:PDB:NREP 1 BL:PDB:REP 37->303|1sw4A|1e-20|27.0|256/270| RP:PFM:NREP 1 RP:PFM:REP 33->296|PF04069|5e-20|36.7|237/256|OpuAC| HM:PFM:NREP 1 HM:PFM:REP 24->298|PF04069|1.8e-59|32.7|248/257|OpuAC| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF04069|IPR007210| GO:PFM GO:0005488|"GO:binding"|PF04069|IPR007210| GO:PFM GO:0006810|"GO:transport"|PF04069|IPR007210| RP:SCP:NREP 1 RP:SCP:REP 30->303|1sw1A|9e-77|27.0|263/271|c.94.1.1| HM:SCP:REP 23->303|1sw5A_|2.1e-54|33.7|270/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 482 OP:NHOMOORG 382 OP:PATTERN -----------------------1--------1-------------------1-------2------- --1-1-------1-21111-12--2211111112221233-1-11--1--1-211-11--111-111211----------1-2----------------------1-1-------------------------------11---1-1-1111111------------111-------------111-------211111111-1111112---221111111121111111-1222222222222222233232-21--1-1-12211--211-1-11111111-112211111111111111111111111111111-1111---2211111111111211111111---1----11----11-11----11-------------1-----------11111111111-1111111111--211-11121122-------1----------------------1----------------------------------------1222212111111--1111112112222--1---------2112-------2----------------1--1-----------------------1-------------1------------------------------------------------1---------32---2-1111111111-1111111111111111112121-----222222222222222211-11111--1-2-122-1111----11111------14-----1----------------------1111111111111-111-------------------------------111----------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 260 STR:RPRED 85.8 SQ:SECSTR ####################################HHHHHHHHHHHTTTcEEEEccccccHHHHHHHHHTTcccEEEEEHHHHHHTTccccccccccHHHHHHHHHHHHHHHHccEEEEEEEEEccEEEEEEHHHHHHHTcccGGGGTTT###GGGcEEEEcTTTTTcTTcHHHHHHHHcccccEEEcTTH###EccGGGHHHHHHTTccccEEEETTcTHHHHTTEEEcccTTccccccEEEEEEcHHHHTcHHHH#HHHGGGTTcccHHHHHHHHHHHHTccccHHHHHHHHHHHTTccc DISOP:02AL 302-304| PSIPRED cHHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHccccEEEEEccHHHHHHccccccccccHHHHHHHHHHHHHccccEEEEcccccccEEEEEEcHHHHHHcccccHHHHHHHHHccccEEEEccHHHcccHHHHHHHHHHHccccccccEEEcccccccHHHHHHHHHccccEEEEEEcccccccccccEEEEccccccccccEEEEEEHHHHHHcHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHccccc //