[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86028.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:114 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   29->75 1biaA PDBj 6e-05 15.2 %
:RPS:SCOP  28->102 2ethA1  a.4.5.28 * 8e-05 23.0 %
:HMM:SCOP  1->114 1p4xA2 a.4.5.28 * 2e-14 31.9 %
:HMM:PFM   29->88 PF01047 * MarR 5.4e-14 44.1 59/59  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86028.2 GT:GENE AAK86028.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 215253..215597 GB:FROM 215253 GB:TO 215597 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86028.2 GB:DB_XREF GI:159139540 LENGTH 114 SQ:AASEQ MPAQLSPTEALGLWHRVSTAQVIDDQPDLTLRQTAILLQIYLVPPPHTVRGLAAMLGVTKPVITRALDSLGALGLVDRVRDERDRRNVVIKRTVAGALYLEKFGDLIIDQARKI GT:EXON 1|1-114:0| SEG 76->89|vdrvrderdrrnvv| RP:PDB:NREP 1 RP:PDB:REP 29->75|1biaA|6e-05|15.2|46/292| HM:PFM:NREP 1 HM:PFM:REP 29->88|PF01047|5.4e-14|44.1|59/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 28->102|2ethA1|8e-05|23.0|74/140|a.4.5.28| HM:SCP:REP 1->114|1p4xA2|2e-14|31.9|113/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 45 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111---------111-111111111111--111----------11111111-1111111--------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 79.8 SQ:SECSTR #######################cccccccHHHHHHHHHHTcTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEcccEEEEEcTTHHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 1-4,114-115| PSIPRED ccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccHHHHHHHHcccccHHHHHHHHHHHcccEEEcccHHHcEEEEEEEcHHHHHHHHHHHHHHHHHHHcc //