[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86045.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  99/915 : Eukaryota  75/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->90 2fa8B PDBj 7e-48 100.0 %
:RPS:PDB   5->86 3dexH PDBj 8e-35 48.1 %
:HMM:SCOP  4->89 2fa8A1 c.47.1.23 * 2.1e-30 52.3 %
:RPS:PFM   7->80 PF10262 * Rdx 4e-25 58.1 %
:HMM:PFM   6->80 PF10262 * Rdx 1.1e-37 60.0 75/76  
:BLT:SWISS 3->79 CQ037_BOVIN 2e-05 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86045.1 GT:GENE AAK86045.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(231038..231343) GB:FROM 231038 GB:TO 231343 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86045.1 GB:DB_XREF GI:15155118 LENGTH 101 SQ:AASEQ MTETKPRIAIRYCTQCNWLLRAGWMAQEILQTFASDIGEVSLIPSTGGLFEITVDGTIIWERKRDGGFPGPKELKQRIRDLIDPERDLGHVDRTKHEGLDT GT:EXON 1|1-101:0| BL:SWS:NREP 1 BL:SWS:REP 3->79|CQ037_BOVIN|2e-05|33.3|75/115| BL:PDB:NREP 1 BL:PDB:REP 4->90|2fa8B|7e-48|100.0|86/86| RP:PDB:NREP 1 RP:PDB:REP 5->86|3dexH|8e-35|48.1|81/83| RP:PFM:NREP 1 RP:PFM:REP 7->80|PF10262|4e-25|58.1|74/76|Rdx| HM:PFM:NREP 1 HM:PFM:REP 6->80|PF10262|1.1e-37|60.0|75/76|Rdx| GO:PFM:NREP 2 GO:PFM GO:0008430|"GO:selenium binding"|PF10262|IPR019389| GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF10262|IPR019389| HM:SCP:REP 4->89|2fa8A1|2.1e-30|52.3|86/0|c.47.1.23|1/1|Thioredoxin-like| OP:NHOMO 175 OP:NHOMOORG 174 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-11-1-1-----------------------1-------------------------------------1-1-1-----------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------11111111111-1111111111--111111111111-------------1------------1----------------------------------------1111------------------------------------------------111--------------------------------------------1-----------------------------111-11---------------------------1---------------1------------------------------111--------------------------------------------------------11111-------------------------1111111111111111111--------------1111111111------------------------------------------------------------------------- --------------1111-111111111111111111111111111-111111111111111111111----111-----1---1-------1-111-11---111--2--------------------------------------------------------------------------------1--1111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 88.1 SQ:SECSTR #ccccEEEEEEEETTTTcHHHHHHHHHHHHHHcTTTEEEEEEEEEccccEEEEETTEEEEEHHHHHccccHHHHHHHHHHHccccccccc########### DISOP:02AL 1-4, 92-101| PSIPRED ccccccEEEEEEccccccccHHHHHHHHHHHHccccccEEEEEEccccEEEEEEccEEEEEEEcccccccHHHHHHHHHHHHccccccccccccccccccc //