[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86046.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   29->106 PF07681 * DoxX 1.5e-17 32.1 78/85  
:HMM:PFM   68->147 PF04173 * DoxD 7.9e-06 25.0 80/167  
:BLT:SWISS 21->119 CATD_BACSU 1e-06 35.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86046.2 GT:GENE AAK86046.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 231481..231930 GB:FROM 231481 GB:TO 231930 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86046.2 GB:DB_XREF GI:159139549 LENGTH 149 SQ:AASEQ MAQFENNRQRLFVPAVAPLYNSTHDLVETILRVAAGLLLVTHGFGKIVNPFGAVGMVESLGFHPGVFWSPLLAATEFFGGILVAIGLFTRPASFAAMIVLLVTVYFHGIVKAEGLGGAEKSILWAAIFLFFAVRGGNRHSVDAKLTREF GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 21->119|CATD_BACSU|1e-06|35.5|93/134| TM:NTM 4 TM:REGION 16->38| TM:REGION 67->89| TM:REGION 91->113| TM:REGION 115->136| HM:PFM:NREP 2 HM:PFM:REP 29->106|PF07681|1.5e-17|32.1|78/85|DoxX| HM:PFM:REP 68->147|PF04173|7.9e-06|25.0|80/167|DoxD| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------111----1----------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--1---11--------1-11----------------------------------------------------------1----------------------------------------1-----------------------------------------------1---------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------1---------------------------1111-------------------------------------------------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHc //