[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86050.1
DDBJ      :             conserved hypothetical protein, membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  127/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:291 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  40->146 1s7bA_ f.39.1.1 * 1.4e-05 21.9 %
:HMM:SCOP  186->291 1s7bA_ f.39.1.1 * 3.9e-08 20.8 %
:HMM:PFM   16->135 PF00892 * EamA 2.8e-15 23.3 120/126  
:HMM:PFM   163->282 PF00892 * EamA 6e-15 16.0 119/126  
:BLT:SWISS 86->237 Y510_ARCFU 9e-08 21.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86050.1 GT:GENE AAK86050.1 GT:PRODUCT conserved hypothetical protein, membrane protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(234325..235200) GB:FROM 234325 GB:TO 235200 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein, membrane protein GB:PROTEIN_ID AAK86050.1 GB:DB_XREF GI:15155123 LENGTH 291 SQ:AASEQ MDKTTSGWLNGLTGVVIFSGSLPATRLAVTGFDPVFLTAARASIAGLLALALLFLFRQKRPARGDLTSLIIVSIGVVVGFPLLTALALRHVTSAHSIIFVGLLPLATAIFAVMRGGERPRPVFWLFSCLGSALVAGFSLSNSFAARIEASLAGDLLMLGAIIVCGLGYAEGAALSRKLGGWQVISWALVLSLPVMLPLAFFTGPETLGGIDPQAWGGLAYVSLFSMLIGFIFWYRGLALGGIAAVGQLQLLQPFFGLALAATLLHEEVSPAMIGVTLVVVLCVAGARKFAR GT:EXON 1|1-291:0| BL:SWS:NREP 1 BL:SWS:REP 86->237|Y510_ARCFU|9e-08|21.5|149/289| TM:NTM 10 TM:REGION 4->26| TM:REGION 32->54| TM:REGION 66->88| TM:REGION 93->114| TM:REGION 122->144| TM:REGION 151->173| TM:REGION 180->202| TM:REGION 215->237| TM:REGION 242->264| TM:REGION 266->286| SEG 39->55|aarasiagllalallfl| SEG 70->79|iivsigvvvg| SEG 246->261|gqlqllqpffglalaa| HM:PFM:NREP 2 HM:PFM:REP 16->135|PF00892|2.8e-15|23.3|120/126|EamA| HM:PFM:REP 163->282|PF00892|6e-15|16.0|119/126|EamA| HM:SCP:REP 40->146|1s7bA_|1.4e-05|21.9|105/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 186->291|1s7bA_|3.9e-08|20.8|101/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 145 OP:NHOMOORG 128 OP:PATTERN -------------------------------------------------------------------- --------------1----------1-----------1-------------1111------1-----111---------------------------------------------------------------------------1-----------------------------------------------1--------------------1----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------1211--1-----1111111-111-1111111111--11111111111121-----1----------------------------------------------------------121-12222222111122111111112211111-1111111--11111111--------------111----------------------------------------------------------------------------------------------------------1------------------------------------11---------------------1--------------------------------------1---------------1111111---1------222-1111----------------------------11----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccc //