[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86053.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  154/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.49.1
:152 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->81 1ylfC PDBj 6e-09 37.3 %
:RPS:PDB   7->79 2b0lA PDBj 1e-05 18.1 %
:RPS:SCOP  11->98 1f6vA  a.49.1.1 * 4e-08 10.1 %
:HMM:SCOP  5->133 1xd7A_ a.4.5.55 * 2.7e-32 37.0 %
:RPS:PFM   1->81 PF02082 * Rrf2 2e-11 40.7 %
:HMM:PFM   1->81 PF02082 * Rrf2 7e-27 40.7 81/83  
:BLT:SWISS 4->128 YWNA_BACSU 9e-10 30.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86053.1 GT:GENE AAK86053.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(237190..237648) GB:FROM 237190 GB:TO 237648 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86053.1 GB:DB_XREF GI:15155126 LENGTH 152 SQ:AASEQ MRHDTRLSRVLHILIHMEKHEGAATSENIAAMLQTNPVVVRRTMAGLREHGYVSSEKGHGGGWVLAQPLTEITLLDIYRALGAPELFSIGLAGDNPNCVIEQAVNAALFDAMNEAENILLSRFGSITLSTLAEESIDRWSKLSNCPSAMEQL GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 4->128|YWNA_BACSU|9e-10|30.1|123/133| BL:PDB:NREP 1 BL:PDB:REP 5->81|1ylfC|6e-09|37.3|75/115| RP:PDB:NREP 1 RP:PDB:REP 7->79|2b0lA|1e-05|18.1|72/98| RP:PFM:NREP 1 RP:PFM:REP 1->81|PF02082|2e-11|40.7|81/83|Rrf2| HM:PFM:NREP 1 HM:PFM:REP 1->81|PF02082|7e-27|40.7|81/83|Rrf2| RP:SCP:NREP 1 RP:SCP:REP 11->98|1f6vA|4e-08|10.1|79/91|a.49.1.1| HM:SCP:REP 5->133|1xd7A_|2.7e-32|37.0|127/127|a.4.5.55|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 192 OP:NHOMOORG 154 OP:PATTERN -------------------------------------------------------------------- 1-----------------------------------------------------------------1-1------------2-------------------------1------------------------------------1--------------------------------------11--------222222222-22222211112-222-1-1-1-111-1123--------------------1-11--11---11----111-1---------------------------------------11---111------1111111-1-------------------11---------------1-1-----------1------1-11----------1-11-11-11--1-133----11111---1-112---11--------------11----------------------------------1------1212312-1111---21111-12--1112----1--1--1---1--1----------------------------------------------1-11----------------------------------1-1-----------1-----------------------------------------------------------------11------------------------------------------------------2-1--------------------------11111---1---------------------------------11-1111-------------1111--------2--------------------1-----------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 84.2 SQ:SECSTR ccccHHHHHHHHHTTcccTTEEEEcHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEcccccEEEEEccHHHcHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHTTccH######################## PSIPRED cccHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccccccHHHccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHc //