[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86058.1
DDBJ      :             carbon-nitrogen hydrolase
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  228/915 : Eukaryota  43/199 : Viruses  0/175   --->[See Alignment]
d.160.1
:289 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   55->211 1f89A PDBj 2e-12 31.2 %
:RPS:PDB   3->288 2e2kE PDBj 2e-31 13.2 %
:RPS:SCOP  3->288 1erzA  d.160.1.2 * 8e-29 18.5 %
:HMM:SCOP  2->281 1emsA2 d.160.1.1 * 1.1e-48 31.2 %
:RPS:PFM   95->181 PF00795 * CN_hydrolase 1e-08 40.7 %
:HMM:PFM   4->181 PF00795 * CN_hydrolase 9.2e-20 29.1 172/184  
:BLT:SWISS 64->282 YHCX_BACSU 2e-30 34.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86058.1 GT:GENE AAK86058.1 GT:PRODUCT carbon-nitrogen hydrolase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(241938..242807) GB:FROM 241938 GB:TO 242807 GB:DIRECTION - GB:PRODUCT carbon-nitrogen hydrolase GB:PROTEIN_ID AAK86058.1 GB:DB_XREF GI:15155133 LENGTH 289 SQ:AASEQ MTRLAASQYAIELIETWEAYAAHLSAIVREAKEKGAELLLLPEYSAMALTGQLPPDARSDLHRSIEEIQPLIPSWVELCEELARQHQILFQPGSAPVKDPDGRFRNRAWLFGPDGLIGYQDKQIMTRFEREQWNIHAGVEGLKAFETSIGRLGILICYDNEFPMLGRKLAELGVELVLAPSCTDTLAGAYRVRIGAQARALENQYAVLSSPTAGEAPWSPAVDENRGRAALYVPSDYGMPASGILAESESDAVTESLMLIADIDLATVARLRTEGQVATRRDWPEQFAV GT:EXON 1|1-289:0| BL:SWS:NREP 1 BL:SWS:REP 64->282|YHCX_BACSU|2e-30|34.1|214/513| SEG 30->43|eakekgaellllpe| BL:PDB:NREP 1 BL:PDB:REP 55->211|1f89A|2e-12|31.2|154/271| RP:PDB:NREP 1 RP:PDB:REP 3->288|2e2kE|2e-31|13.2|266/315| RP:PFM:NREP 1 RP:PFM:REP 95->181|PF00795|1e-08|40.7|86/171|CN_hydrolase| HM:PFM:NREP 1 HM:PFM:REP 4->181|PF00795|9.2e-20|29.1|172/184|CN_hydrolase| GO:PFM:NREP 2 GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00795|IPR003010| GO:PFM GO:0016810|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds"|PF00795|IPR003010| RP:SCP:NREP 1 RP:SCP:REP 3->288|1erzA|8e-29|18.5|271/303|d.160.1.2| HM:SCP:REP 2->281|1emsA2|1.1e-48|31.2|253/0|d.160.1.1|1/1|Carbon-nitrogen hydrolase| OP:NHOMO 322 OP:NHOMOORG 276 OP:PATTERN -----------------------1---------------------------------111---1---- --------------1---------------------1-2--112-1------1-----------1--32-------------------1111-1-----1-1-11111-1------------------------11-----------------11----------1----1-111---1-11-111------11---------------221111----1-----------111------------------------------------------------------------------------------------------3--------------1---------------1---1--11-----------11----------1-111-1-1--------------12111111111-122-1111221111221-312233122--------1---1---------------------------------11-1--11-1111-1-1------11------1-1------111-----1-----1------1-----------1---211-1-----------------1--1-11----------------------1---------1111211111111-1111111111111---1222---------------------------------------------------1111111111111111----------1--------------------111121123----------------------221--1111-11121121-1111---------1111------1-22--11111111----------1111------------------------------------------------- --------21-------1-----111----------1----------1--------------1-------1----------------1-1---------------------13111------111111-121-1-11-----11------1--1---12--11----------------------1-1------1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 288 STR:RPRED 99.7 SQ:SECSTR EEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHcTTEEEccTTTTTcccTTTTTcGTTTcGGGccccccTTHHHHHHHHHHHTcEEEEEEEEccccTcccEEEEEEEcTTccEEEEEEcccccTTTcccccccccccccEEcGGGcEEEEEEGGGGGcHHHHHHHHHTTccEEEEEEccccccHHHHHHHHHHHHHHHHTcEEEEEEccccccccccEcEEEEEEEEccccEEEcTTccEEEEccccTTEccEEEEEEEcHHHHHHHHHHccTTcHHHHTTccc# DISOP:02AL 288-290| PSIPRED cEEEEEEEccccccccHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEEEEEccccEEEEEEEEEccccEEEEEEEEcccccccccEEEccccccEEEEEEccEEEEEEEcHHHHcHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccEEEEcccEEEcccccEEEEcccccccccEEEEEEEcHHHHHHHHHHcccccccccHHHHcc //