[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86063.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  82/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:357 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->116 3f98A PDBj 3e-06 39.5 %
:RPS:PDB   82->321 1e89B PDBj 3e-11 11.9 %
:RPS:SCOP  78->305 1dwoA  c.69.1.20 * 2e-11 14.2 %
:HMM:SCOP  4->356 1jfrA_ c.69.1.16 * 1.1e-32 27.3 %
:RPS:PFM   68->175 PF03403 * PAF-AH_p_II 2e-11 36.5 %
:HMM:PFM   68->117 PF03403 * PAF-AH_p_II 3.7e-07 34.0 50/381  
:HMM:PFM   99->182 PF00326 * Peptidase_S9 8e-05 21.7 83/213  
:HMM:PFM   254->305 PF00561 * Abhydrolase_1 0.00062 25.5 51/231  
:BLT:SWISS 84->169 YCJY_ECOLI 5e-06 36.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86063.2 GT:GENE AAK86063.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(245112..246185) GB:FROM 245112 GB:TO 246185 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86063.2 GB:DB_XREF GI:159139557 LENGTH 357 SQ:AASEQ MRTFTTITTFLFSALAIQPLFAGEAVGVSDIAIHSPDRGKDLAVTIWYPSDGKGTQVLSGEDRIFQGTPAFKDAAVQPGRLPLVLLSHGSGSRVSGMAWIAEKLASEGFIVAGTNHPGTTSGDSTPADTPKIWERTSDLSAIVTALTTQGKWSASIDAGRIGVLGFSLGGSAAMEISGARADLEAYARYCEKEAAMMDCQWFDGGQAYVNNEPVSVPKLDLRTLDKARFEQQNRDPRIRSAVLVDPGLALAFQPESLRKIDIPLTFINLGSKGKIPPAVLADRLAAEVPGATYRQVDEADHFSFLPLCKEGASAFLKSVGERDPICEPTGPRDRSDIHAELEKMIVAAFNRTLKPGQ GT:EXON 1|1-357:0| BL:SWS:NREP 1 BL:SWS:REP 84->169|YCJY_ECOLI|5e-06|36.2|80/306| BL:PDB:NREP 1 BL:PDB:REP 31->116|3f98A|3e-06|39.5|86/377| RP:PDB:NREP 1 RP:PDB:REP 82->321|1e89B|3e-11|11.9|226/258| RP:PFM:NREP 1 RP:PFM:REP 68->175|PF03403|2e-11|36.5|104/216|PAF-AH_p_II| HM:PFM:NREP 3 HM:PFM:REP 68->117|PF03403|3.7e-07|34.0|50/381|PAF-AH_p_II| HM:PFM:REP 99->182|PF00326|8e-05|21.7|83/213|Peptidase_S9| HM:PFM:REP 254->305|PF00561|0.00062|25.5|51/231|Abhydrolase_1| GO:PFM:NREP 2 GO:PFM GO:0003847|"GO:1-alkyl-2-acetylglycerophosphocholine esterase activity"|PF03403|IPR005065| GO:PFM GO:0016042|"GO:lipid catabolic process"|PF03403|IPR005065| RP:SCP:NREP 1 RP:SCP:REP 78->305|1dwoA|2e-11|14.2|218/262|c.69.1.20| HM:SCP:REP 4->356|1jfrA_|1.1e-32|27.3|256/260|c.69.1.16|1/1|alpha/beta-Hydrolases| OP:NHOMO 104 OP:NHOMOORG 82 OP:PATTERN -------------------------------------------------------------------- -1----------------------1----------------1-1-----------------1----------------------------------------------------------------------------------1-1452112--11-------1111221-------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---------14---------------------------1----1222111211--------1-----1-1---------------1-----------------------------------------11-1-1------1----1--11----1----1----------1-----------------------------1---1111--------------------------------------------1---------------1---------------------------1--------------------------------------111------------------1---------1--------------------------2-1-------------------------------2212-111--111---------------------1--1----------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 341 STR:RPRED 95.5 SQ:SECSTR #############cccccTHHHHccEEEEEEEEEcTTcccEEEEEEEEETTcccEEEEEcEEEEEETTEEEEEEEEEEccccEEEEEccTTccGGGGTTHHHHHHHTTcEEEEEccTTcTcTTccccGGGcccHHHHTHHHHHHHHHccTTcHHHHHHHcEEEEEEGGGHHHHHHHHccccccccccTTHHHHHHHHHccccTTcEEETTccEEEEEEccHHHHHHHTcTTccHHHHHHHHHHcccccccHHHccTTTGGGccEEEEEEcTTcccccHHHHHHHHHHccccEEEEcccccccHHHTTccHcHHHHHHHHHHEEEETTcccTccHHHHTcccHHHHHHHTHHHHc### DISOP:02AL 1-1,356-358| PSIPRED ccHHHHHHHHHHHHHHcccccccccccEEEEEEccccccccEEEEEEEccccccccEEEccccEEccEEEEcccccccccccEEEEEccccccHHHHHHHHHHHHHcccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEcHHHHHHHHHHcccccHHHHHHHHcccccccccccHHHHHHHHHcccccccccHHHHccHHccccccccHHHHHHHHHcccccccccHHHHHHccccEEEEEccccccccHHHHHHHHHHHccccEEEEEcccccccccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHccccc //