[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86066.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  119/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.1.1
:135 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->112 2ig3B PDBj 1e-12 32.7 %
:RPS:PDB   18->115 1dlwA PDBj 4e-13 14.7 %
:RPS:SCOP  8->116 1ngkA  a.1.1.1 * 1e-07 19.8 %
:HMM:SCOP  7->120 1ngkA_ a.1.1.1 * 8.9e-21 29.1 %
:RPS:PFM   14->112 PF01152 * Bac_globin 4e-04 27.3 %
:HMM:PFM   3->113 PF01152 * Bac_globin 1e-05 19.8 106/120  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86066.2 GT:GENE AAK86066.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(248655..249062) GB:FROM 248655 GB:TO 249062 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86066.2 GB:DB_XREF GI:159139558 LENGTH 135 SQ:AASEQ MAEIGVDAAFIDLLVETFYGRVLEHQTLGPVFDARLAGRWPEHMARMKQFWTAIAFKNGSYGGKPVQAHLGVQGMSAELFPQWLALFSVTLDDIAPSRKAHDWFMETAERIARSLTLSLFYNPAMDDPAVKRSRS GT:EXON 1|1-135:0| BL:PDB:NREP 1 BL:PDB:REP 14->112|2ig3B|1e-12|32.7|98/124| RP:PDB:NREP 1 RP:PDB:REP 18->115|1dlwA|4e-13|14.7|95/116| RP:PFM:NREP 1 RP:PFM:REP 14->112|PF01152|4e-04|27.3|99/120|Bac_globin| HM:PFM:NREP 1 HM:PFM:REP 3->113|PF01152|1e-05|19.8|106/120|Bac_globin| GO:PFM:NREP 2 GO:PFM GO:0015671|"GO:oxygen transport"|PF01152|IPR001486| GO:PFM GO:0019825|"GO:oxygen binding"|PF01152|IPR001486| RP:SCP:NREP 1 RP:SCP:REP 8->116|1ngkA|1e-07|19.8|106/126|a.1.1.1| HM:SCP:REP 7->120|1ngkA_|8.9e-21|29.1|110/0|a.1.1.1|1/1|Globin-like| OP:NHOMO 130 OP:NHOMOORG 121 OP:PATTERN -------------------------------------------------------------------- 1--------------1-------------------------------------------------------------------------------------1-112------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1112------21111111--1-11111111111-111111111-1-111-11111111131211-1-----12111111111-----1--------------------------------121--111-1111111-1111111111111111-----------1---1----11---------------21---1----------------------------------1-111111-1-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------1------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 84.4 SQ:SECSTR #HHTTHHHH#HHHHHHHHHHHHHTcTTTGGGGTTccHccHHHHHHHHHHHHHHHTTcccccccccHHHHHTTccccHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHTTHHHHc################### DISOP:02AL 1-1,127-136| PSIPRED cccccccHHHHHHHHHHHHHHHHcccccccccHHHHccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcc //