[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86068.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   18->169 1e2tA PDBj 4e-12 16.7 %
:RPS:PFM   41->140 PF06035 * DUF920 6e-20 41.0 %
:HMM:PFM   1->168 PF06035 * DUF920 1.6e-74 54.8 168/170  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86068.2 GT:GENE AAK86068.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(250317..250832) GB:FROM 250317 GB:TO 250832 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86068.2 GB:DB_XREF GI:159139559 LENGTH 171 SQ:AASEQ MVTGGITSQPIGHYEFCQKYADECNIRSKVTPPPRVTDYGWGVIREINTSVNTTIVAMTDQEIYGKDEVWEYPTTAGDCEDFVLLKRKKLIERGFSVADLLITVVRKPDGEGHAVLTLRTTDGDYILDNLTDDVKLWTDTNYTYLKRQASFNTGRWISIEDGRDVLVGALR GT:EXON 1|1-171:0| RP:PDB:NREP 1 RP:PDB:REP 18->169|1e2tA|4e-12|16.7|150/274| RP:PFM:NREP 1 RP:PFM:REP 41->140|PF06035|6e-20|41.0|100/123|DUF920| HM:PFM:NREP 1 HM:PFM:REP 1->168|PF06035|1.6e-74|54.8|168/170|DUF920| OP:NHOMO 134 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----112321112111123232333333-34334333441-34424542443311----------1----------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 154 STR:RPRED 90.1 SQ:SECSTR #################HHHHHHTTccccccccHHHHHHHHHHccEEcHHHHTTccccccTTHHHHHHTTTHHcccccHHHHHHHHHHHHHHTTccEEEEEEEEcTTcccccEEEEEEEETTEEEEEcccccTTcccccEEccccccEEETTEEEEEEccTTcEEEEEEET DISOP:02AL 1-2,26-27,29-34,165-172| PSIPRED ccccccccccHHHHHHHHccHHHccccccccccEEEcHHHHHHHHHHHHHHHHccEEcccHHHHcccccccccccccccHHHHHHHHHHHHHccccHHccEEEEEEcccccEEEEEEEEcccccEEEcccccccccHHHcccEEccEEEEccccEEEEcccccccHHHccc //