[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86081.2
DDBJ      :             hydrolase
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  169/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
c.33.1
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->185 3irvA PDBj 4e-12 28.1 %
:RPS:PDB   3->174 2a67A PDBj 3e-23 27.8 %
:RPS:SCOP  4->179 1nf8A  c.33.1.3 * 5e-27 20.9 %
:HMM:SCOP  1->182 1nbaA_ c.33.1.3 * 3.3e-34 35.1 %
:RPS:PFM   7->146 PF00857 * Isochorismatase 3e-20 41.4 %
:HMM:PFM   6->145 PF00857 * Isochorismatase 4.5e-29 35.3 139/174  
:BLT:SWISS 7->179 YRDC_BACSU 4e-14 28.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86081.2 GT:GENE AAK86081.2 GT:PRODUCT hydrolase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(262523..263083) GB:FROM 262523 GB:TO 263083 GB:DIRECTION - GB:PRODUCT hydrolase GB:PROTEIN_ID AAK86081.2 GB:DB_XREF GI:159139565 LENGTH 186 SQ:AASEQ MSSSNTALLVIDVQESFRHAPYFEESGLAAYLEKQQALIDGAKAAGIPVVQIFHVDGDRAFSKDSGYIRALEGVRITPDVTFHKSRHSAFAGTGLEIWLTQRGINRLIVSGIRTEQCCETTTRHASDLGYSVDYITEATLTFPMTHPSGTVFSADDIRKRTELVLAGRFARIATVSEALAPLKAAA GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 7->179|YRDC_BACSU|4e-14|28.7|171/187| BL:PDB:NREP 1 BL:PDB:REP 6->185|3irvA|4e-12|28.1|178/213| RP:PDB:NREP 1 RP:PDB:REP 3->174|2a67A|3e-23|27.8|162/163| RP:PFM:NREP 1 RP:PFM:REP 7->146|PF00857|3e-20|41.4|140/173|Isochorismatase| HM:PFM:NREP 1 HM:PFM:REP 6->145|PF00857|4.5e-29|35.3|139/174|Isochorismatase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| RP:SCP:NREP 1 RP:SCP:REP 4->179|1nf8A|5e-27|20.9|163/207|c.33.1.3| HM:SCP:REP 1->182|1nbaA_|3.3e-34|35.1|171/253|c.33.1.3|1/1|Isochorismatase-like hydrolases| OP:NHOMO 250 OP:NHOMOORG 188 OP:PATTERN -------1----------------1---1-11-----------1--11-------------------- -11-1----------------1--------------1----1--1-------1----1------1-1-31-------------------------------1-------------------------------------------------------------------------------------------122222212-222222----11222------1------11--------------------1--------------------------------1--11111111111---------------------------1111--------------------------------------------1-----------1--------------------1-11111--1-1--11111-2111-11-1-----------------------1---1----------------------------------111111344441-----2211-----22111111--11---1--21113---1-1--21-----------1-----------111--111-111-------------------------------------------------1111---121----------------------11--11-------------------------------1----------------------3---------1--------------------------1-1---------------11111-1---1-333313222111--323------------1-----------------------------------------------------------------------1---11-1-1-1- -----1--------1-------1----------1-1-----------1-------1------------------------------------------------------------------------------------------------------1------1-------------------1-----1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 99.5 SQ:SECSTR cccccEEEEEEcccTTcccTcccccTTHHHHHHHHHHHHHHHHHTTccEEEEEEEEccTTccTTcTTTcccTTccccTcEEEEEccccTTTTccHHHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHHTcEEEcTTcEEccccccccccccccHHHHHHHHHHHHcTTTcEEcccHHHHHHHHHH# DISOP:02AL 1-1,186-187| PSIPRED cccccEEEEEEcccHHHccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccEEEEcccccccccHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHcccEEEEEccccccccccccccccccHHHHHHHHHHHHHHcccEEEEHHHHHHHHHccc //