[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86093.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.61.1
:295 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   94->261 2d4gA PDBj 2e-11 18.8 %
:RPS:SCOP  94->264 1iuhA  d.61.1.2 * 1e-13 18.0 %
:HMM:SCOP  90->261 1iuhA_ d.61.1.2 * 5e-18 29.8 %
:HMM:PFM   96->174 PF02834 * 2_5_RNA_ligase 2.3e-11 32.9 76/87  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86093.1 GT:GENE AAK86093.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(272904..273791) GB:FROM 272904 GB:TO 273791 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86093.1 GB:DB_XREF GI:15155172 LENGTH 295 SQ:AASEQ MRDTYQLVGRLSMVPCHKAIDLSGMRRGHRNSFSFCSFNFSLAMIMSRAWNRPWSIVMGLELTDKEGLRQLFLEGFELEKQRRINPRFSSKVLIVVKPPAALAERIFTDASSHAAGRTKREAYPAELLHITLLCVGCFDTVPRGLANRLKEALGEIRARPVPITFDGSSLFGNRNCLVLNSRREMLELRALAKVVQRALWRANLPYIAASSFMPHLTMIYGCGKIETMPVEKPYSWLAGSFEVIFSHNGETRHESLGRFALSAKADRYEQPESQLYLPQKVFGPSKRPTHKIAAR GT:EXON 1|1-295:0| SEG 31->41|nsfsfcsfnfs| RP:PDB:NREP 1 RP:PDB:REP 94->261|2d4gA|2e-11|18.8|154/165| HM:PFM:NREP 1 HM:PFM:REP 96->174|PF02834|2.3e-11|32.9|76/87|2_5_RNA_ligase| RP:SCP:NREP 1 RP:SCP:REP 94->264|1iuhA|1e-13|18.0|167/183|d.61.1.2| HM:SCP:REP 90->261|1iuhA_|5e-18|29.8|168/183|d.61.1.2|1/1|LigT-like| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----11---------------------------------------------------------------------------1111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 154 STR:RPRED 52.2 SQ:SECSTR #############################################################################################EEccccHHHHHHHHHHHHHHcG######GGGTccccccccccEE###ccGGGHHHHHHHHHHHHHTcEEEEEEEEEcTTTcccEEEEEccc#HHHHHHH####HHTTcGGGccccccccccEEEEEccccHHHHHHHHHHTccccEEEEEEEEEcTTccEEEEEEEEc################################## DISOP:02AL 1-3, 289-295| PSIPRED cccHHHHHHHHHccccHHHHcHHHHccccccccEEEEEcHHHHHHHHHHccccEEEEEEEEEccccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHccccccccccHHHHHEHHHEEcccccccHHHHHHHHHHHHHHccccEEEEEEEEEEcccccEEEEEEccccHHHHHHHHHHHHHHHHcccccccccccccEEEEEEccccccccccccccEEEccEEEEEEEEcccccEEEEEEEccccccccccccHHHEEccHHHcccccccccccccc //