[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86098.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  91/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->126 3e1eD PDBj 3e-32 49.2 %
:RPS:PDB   8->143 3e1eB PDBj 2e-21 47.8 %
:RPS:SCOP  21->141 1zkiA1  d.38.1.5 * 2e-20 17.1 %
:HMM:SCOP  12->141 1zkiA1 d.38.1.5 * 1.4e-27 25.6 %
:HMM:PFM   52->125 PF03061 * 4HBT 1.8e-13 20.3 74/79  
:BLT:SWISS 32->142 Y1253_SULSO 5e-12 34.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86098.1 GT:GENE AAK86098.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(277369..277818) GB:FROM 277369 GB:TO 277818 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86098.1 GB:DB_XREF GI:15155179 LENGTH 149 SQ:AASEQ MEITDPGDFRQRIETSFARQGVVQAINAEISRIEHRLVEIELPFHEKLTQQHGILHAGVIAAGLDTACTYAAYTIIEPEASLLTIEFKVNLMSPGRGERFLFRGEIIKPGNNLIVADGRAYALSDGPAKLIASMTGTMMVVKGREDITG GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 32->142|Y1253_SULSO|5e-12|34.6|107/150| BL:PDB:NREP 1 BL:PDB:REP 9->126|3e1eD|3e-32|49.2|118/137| RP:PDB:NREP 1 RP:PDB:REP 8->143|3e1eB|2e-21|47.8|136/140| HM:PFM:NREP 1 HM:PFM:REP 52->125|PF03061|1.8e-13|20.3|74/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 21->141|1zkiA1|2e-20|17.1|117/126|d.38.1.5| HM:SCP:REP 12->141|1zkiA1|1.4e-27|25.6|125/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 108 OP:NHOMOORG 99 OP:PATTERN --------1111111----------------------------------------------1------ ------------------------------------------11-------------------------1-----------------------1-------------------------------------------11-----1---------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------2----------11111111111---------111-11111111111111-1-11211211-1-------------11-------------------------------------1111111111-------1-------2112232-----1-11111111---1-----------------11111--------------------1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------11-1----1--------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 96.6 SQ:SECSTR #ccccHHTHHHHHHHHHHTcHHHHHHTcEEEEccTTccEEEEEccGGGccTTccccHHHHHHHHHHHHHHHHHTTcccccEEEEEEEEEEEcccccccEEEEEEEEEEccccEEEEEEEEEEEccccEEEEEEEEEEEEEEccHc#### DISOP:02AL 1-4, 145-149| PSIPRED ccccccHHHHHHHHHHHccccHHHHcccEEEEEcccEEEEEEEEcHHHHccccEEHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEccccccEEEEEEEEEEcccEEEEEEEEEEEEEcccccEEEEEEEEEEEEcccccccc //