[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86112.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  104/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:95 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->95 2fiuA PDBj 1e-48 100.0 %
:RPS:PDB   7->95 3dcaA PDBj 1e-16 22.7 %
:RPS:SCOP  2->95 2fiuA1  d.58.4.16 * 2e-33 97.9 %
:HMM:SCOP  1->95 2fiuA1 d.58.4.16 * 9.5e-37 55.4 %
:RPS:PFM   15->77 PF07045 * DUF1330 9e-10 55.6 %
:HMM:PFM   16->78 PF07045 * DUF1330 2.5e-30 54.0 63/65  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86112.1 GT:GENE AAK86112.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(291257..291544) GB:FROM 291257 GB:TO 291544 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86112.1 GB:DB_XREF GI:15155195 LENGTH 95 SQ:AASEQ MAKGYWIAQVDVRDSERYKDYVSTAKPAFERFGANFLARGGSVTELEGTARARNVVIEFPSVQHAIDCYNSPEYQAAAKIRQEVADAEMMIVEGI GT:EXON 1|1-95:0| BL:PDB:NREP 1 BL:PDB:REP 2->95|2fiuA|1e-48|100.0|92/93| RP:PDB:NREP 1 RP:PDB:REP 7->95|3dcaA|1e-16|22.7|88/127| RP:PFM:NREP 1 RP:PFM:REP 15->77|PF07045|9e-10|55.6|63/65|DUF1330| HM:PFM:NREP 1 HM:PFM:REP 16->78|PF07045|2.5e-30|54.0|63/65|DUF1330| RP:SCP:NREP 1 RP:SCP:REP 2->95|2fiuA1|2e-33|97.9|94/95|d.58.4.16| HM:SCP:REP 1->95|2fiuA1|9.5e-37|55.4|92/0|d.58.4.16|1/1|Dimeric alpha+beta barrel| OP:NHOMO 123 OP:NHOMOORG 106 OP:PATTERN ---------------------------------------------------1---------------- -------------------------2------------1----1-----------------------------------------------------------------------------------------------------------------------------------1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1111--1211111111111111-1111111214--21111121111111---1231111221--------1----1-------------------------------1--1---111------1-----111-1111-----1--1--11---1-11-3-----2-----------------1-----------------------------1--------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------1-----1---------111-1-1---------1-111-111-211------------------------------------------------------------------------------------------------- --------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 98.9 SQ:SECSTR #ccEEEcccccccHHHHHHHHHHHHHHHHHHHTcEEEEEEccccccccTTccEEEEEEEccHHHHHHHTHcHHHHHHHHHHHHHEEEEEEEEccc PSIPRED cccEEEEEEEEEccHHHHHHHHHHHHHHHHHccEEEEEEcccEEEEcccccccEEEEEEccHHHHHHHHccHHHHHHHHHHHcccEEEEEEEEcc //