[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86125.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:170 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   77->138 1o5uA PDBj 1e-11 41.9 %
:RPS:PDB   39->142 3bcwB PDBj 7e-09 26.2 %
:RPS:SCOP  54->139 1o5uA  b.82.1.8 * 1e-17 34.6 %
:HMM:SCOP  55->142 1lknA_ b.82.1.8 * 3.5e-18 30.7 %
:RPS:PFM   70->138 PF05899 * Cupin_3 4e-16 50.7 %
:HMM:PFM   70->139 PF05899 * Cupin_3 3.5e-26 45.7 70/74  
:BLT:SWISS 68->126 EUTQ_ECOLI 3e-04 49.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86125.1 GT:GENE AAK86125.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 301550..302062 GB:FROM 301550 GB:TO 302062 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86125.1 GB:DB_XREF GI:15155210 LENGTH 170 SQ:AASEQ MSFKMMFAAAATMAIRTVPILPAYLRRQKDEAVVSASCTDLRLQPAPINPEWIISGNPQARAADHSRSGDRASSTAMWDCTAGEFRWFFGWDETVYILEGEVHVTAEDGSVSILRVGDVAYFRAGTWATWRVDDYVRKVAFMRRPFPTALALAYRVKNKLFAGRSYKLAA GT:EXON 1|1-170:0| BL:SWS:NREP 1 BL:SWS:REP 68->126|EUTQ_ECOLI|3e-04|49.1|53/233| SEG 5->14|mmfaaaatma| BL:PDB:NREP 1 BL:PDB:REP 77->138|1o5uA|1e-11|41.9|62/88| RP:PDB:NREP 1 RP:PDB:REP 39->142|3bcwB|7e-09|26.2|103/117| RP:PFM:NREP 1 RP:PFM:REP 70->138|PF05899|4e-16|50.7|69/74|Cupin_3| HM:PFM:NREP 1 HM:PFM:REP 70->139|PF05899|3.5e-26|45.7|70/74|Cupin_3| RP:SCP:NREP 1 RP:SCP:REP 54->139|1o5uA|1e-17|34.6|81/88|b.82.1.8| HM:SCP:REP 55->142|1lknA_|3.5e-18|30.7|88/89|b.82.1.8|1/1|RmlC-like cupins| OP:NHOMO 41 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- -------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21----1-11-----------1-111111-1----111111-111--------------------------------------------------------------------------------111-----1111-1---------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1------------------------------------------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 68.2 SQ:SECSTR ######################################cccccccEEEccccEEEccccEEEEEEEEETTTTEEEEEEEEEEEEEEcccTEEEEEEEEEEEEEEEcTTccEEEEEETTcEEEcTTcccEEEEEEEEEEEEEEEEcHHHHHGGGG################ DISOP:02AL 1-3, 6-7| PSIPRED ccEEEEEEcccccccccccccHHHHHHcccccEEEEEEccccEEcccccccccccccccEEEEEEEEcccccEEEEEEEccccEEEEEEccEEEEEEEEEEEEEEEcccEEEEEEccEEEEEccccEEEEEEEcccEEEEEEEccccHHHHHHHHHHHHHHcccEEEEcc //