[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86129.2
DDBJ      :             RhtB family transporter
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  284/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:205 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   20->138 PF01810 * LysE 2e-11 38.7 %
:HMM:PFM   15->196 PF01810 * LysE 8.2e-28 25.8 178/192  
:BLT:SWISS 19->165 Y1627_SYNY3 2e-17 29.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86129.2 GT:GENE AAK86129.2 GT:PRODUCT RhtB family transporter GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(306202..306819) GB:FROM 306202 GB:TO 306819 GB:DIRECTION - GB:PRODUCT RhtB family transporter GB:PROTEIN_ID AAK86129.2 GB:DB_XREF GI:159139579 LENGTH 205 SQ:AASEQ MTLTTLLAYATALFIAAAIPGPGMTAIVARALGSGFRETFFMGLGLVLGDMIYLTGVILGLAFVAQTFQEAFMVLKFAGAAYLLYIAWKLWTAGLLPQDLKARKSTSIPMSFLSGLLITLGNPKTMLFYVALVPTLIDIRMIGPSEYATLLALTFVVLMAVLLPYILLAAKARNLLKRPSALTILNRTAAGILAGTATMIAIRST GT:EXON 1|1-205:0| BL:SWS:NREP 1 BL:SWS:REP 19->165|Y1627_SYNY3|2e-17|29.3|147/206| TM:NTM 5 TM:REGION 7->29| TM:REGION 42->64| TM:REGION 70->92| TM:REGION 123->145| TM:REGION 150->171| SEG 2->18|tlttllayatalfiaaa| SEG 167->178|llaakarnllkr| RP:PFM:NREP 1 RP:PFM:REP 20->138|PF01810|2e-11|38.7|119/190|LysE| HM:PFM:NREP 1 HM:PFM:REP 15->196|PF01810|8.2e-28|25.8|178/192|LysE| GO:PFM:NREP 2 GO:PFM GO:0006865|"GO:amino acid transport"|PF01810|IPR001123| GO:PFM GO:0016020|"GO:membrane"|PF01810|IPR001123| OP:NHOMO 605 OP:NHOMOORG 285 OP:PATTERN -------------------------------------------------------------------- ----1---------------------------2----21--1------------------------2-------------------------------------------------------------1--------------------------11-------1----------------------------------1-2-1-1-1--1-----11-111---------3----------------11111---------------------------------------------------------------------------------------------------------------------------222-111-1--212---1111122122221116-11-114122C-14555245533462-1-1-52----211--------------11--------------------------------1--1221-6667763333365663333136451132--322121--2-2132-----1-11-----------11-11-1-1---2--1--1-11--21---------1-1------1----------1-----122-111-21-1-----1----111-1121------1------11211-43322332333-332332333333233233312123-1211111111111111112111---2--1--------------1------1-1-1519111------------34454221----22223223244421234-----------2141111123721----------1111---------------------------------------------------------1- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 92-110| PSIPRED ccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcc //