[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86134.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  197/915 : Eukaryota  34/199 : Viruses  0/175   --->[See Alignment]
:304 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   124->234 PF04116 * FA_hydroxylase 3e-05 30.6 %
:HMM:PFM   125->235 PF04116 * FA_hydroxylase 2.7e-23 37.8 111/114  
:HMM:PFM   46->141 PF04123 * DUF373 0.00097 19.1 94/344  
:BLT:SWISS 118->156 SC5D_TOBAC 7e-04 35.9 %
:BLT:SWISS 132->259 TM195_MOUSE 1e-12 34.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86134.2 GT:GENE AAK86134.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(310694..311608) GB:FROM 310694 GB:TO 311608 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86134.2 GB:DB_XREF GI:159139581 LENGTH 304 SQ:AASEQ MAKAQVIKQALSYSSWPLVFGGGLAGSYFAFAGSHPIAAFLAVYAGAVLSLFLLERYIPYEVEWLEGDGETMTSIGHTLLTKGLVQLAAAAAAIFPMLAANVLQPLAAMRFDLWPSHLPVIVQVALAVTIAEFGLYWAHRIAHETVFFWRFHALHHSVVRLWVVNTGRFHVADSLFKITLSQIPLYFMGAPLQVFWWLGAVTAFIGILTHCNVDMKTGLLDYIFSTPRLHRWHHSKQLPEGNTNYGENLVIFDILFGSYHNPDRPSSTDIGIKGEIAKGFVPQLLQPFTKEGVRQIIGKDKKVS GT:EXON 1|1-304:0| BL:SWS:NREP 2 BL:SWS:REP 118->156|SC5D_TOBAC|7e-04|35.9|39/271| BL:SWS:REP 132->259|TM195_MOUSE|1e-12|34.2|120/447| TM:NTM 5 TM:REGION 9->31| TM:REGION 37->59| TM:REGION 82->104| TM:REGION 117->139| TM:REGION 184->206| SEG 88->93|aaaaaa| RP:PFM:NREP 1 RP:PFM:REP 124->234|PF04116|3e-05|30.6|111/114|FA_hydroxylase| HM:PFM:NREP 2 HM:PFM:REP 125->235|PF04116|2.7e-23|37.8|111/114|FA_hydroxylase| HM:PFM:REP 46->141|PF04123|0.00097|19.1|94/344|DUF373| GO:PFM:NREP 5 GO:PFM GO:0005506|"GO:iron ion binding"|PF04116|IPR006694| GO:PFM GO:0005783|"GO:endoplasmic reticulum"|PF04116|IPR006694| GO:PFM GO:0006633|"GO:fatty acid biosynthetic process"|PF04116|IPR006694| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF04116|IPR006694| GO:PFM GO:0055114|"GO:oxidation reduction"|PF04116|IPR006694| OP:NHOMO 359 OP:NHOMOORG 231 OP:PATTERN -------------------------------------------------------------------- --1-----------1------2--12------111421-----------------------------1-1-------------------------------3-32212-2------------------111---21-----------1-1----------------1-113-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2111-----1-122----------------------1------22-11111--11-11-11432------1-1--------1-----1-------------------------------321--111--2223223-22222332222224232113-3322-22--421-4---1----2---------------1----1--------2-21---------41--1--------------------------11-412212212222212-111111211-----11-1-------1--------1------------1------------1---11--------------------------------------------------1231-24-1----------------------1111-2222111-111111---1-111111--111-1111112211----------------1-22--11------------------------------------------------- ----33-----------------1-11----------------------------------------------------------------------------1---1--2231----------11---121-1-1--1---1-1-1---1--1-1-------313----2--11--------1----1---1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,296-297,299-305| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccHHHEEEccccccHHccccccccccccHHHHHHHHHHHcccccccccccccccccccHHccHHHHHHHHHHHHHHHHccccccccc //