[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86151.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  65/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:187 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->161 2r19A PDBj 6e-10 35.2 %
:RPS:PFM   47->148 PF03968 * OstA 3e-11 39.2 %
:HMM:PFM   18->164 PF03968 * OstA 1.5e-33 35.1 134/145  
:BLT:SWISS 39->185 Y383_RHIME 4e-49 62.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86151.2 GT:GENE AAK86151.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(327688..328251) GB:FROM 327688 GB:TO 328251 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86151.2 GB:DB_XREF GI:159139590 LENGTH 187 SQ:AASEQ MMQISRPVSLGRTAGLTAAGLFFSCLATVAFAQNTTSSMQGVKLSGDQPIAIESDQLEIRDQERKAYFTGNVKVVQGTTTLQAGKMTVNYKGQGSSLTSGDANIEKIFVDNNVYLTSETQKATADHGEFDMAAQTFILTGKQVVLSEGTNVFTGCKLTVLMNTGQAKLESCGGPVRIMLDPKSQKKQ GT:EXON 1|1-187:0| BL:SWS:NREP 1 BL:SWS:REP 39->185|Y383_RHIME|4e-49|62.6|147/186| BL:PDB:NREP 1 BL:PDB:REP 47->161|2r19A|6e-10|35.2|108/135| RP:PFM:NREP 1 RP:PFM:REP 47->148|PF03968|3e-11|39.2|102/159|OstA| HM:PFM:NREP 1 HM:PFM:REP 18->164|PF03968|1.5e-33|35.1|134/145|OstA| OP:NHOMO 65 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111-1111111-11111111111111--------111111111111111111111111-1-11-11---------------------------------------------------------------------------------------------------------------------------------------------11--1------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 61.0 SQ:SECSTR ##############################################GccEEEEccEEEEETTTTEEEEEEEEEEEETTEEEEEEEEEEEccccTTcEEEEEccEEEEEEccEEEEccTTcccEEEEcEEEGGGTEEEEEEEEEEEETTEEE#EEEEEEEET########################## DISOP:02AL 1-7,43-43,167-172,177-180,183-188| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccEEEEEEEEEEEccccEEEEEEEEEEEEccEEEEEEEEEEEEcccccccccccccEEEEEEEccEEEEccEEEEEEEEEEEEccccEEEEEccEEEEEEcccEEEEEEEEEEEEccEEEEccccccEEEEEccHHHccc //