[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86161.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  213/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:293 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  47->249 1k4jA  d.108.1.3 * 6e-19 11.5 %
:HMM:SCOP  34->261 1kzfA_ d.108.1.3 * 1.4e-38 33.8 %
:HMM:PFM   100->158 PF00583 * Acetyltransf_1 0.00075 25.6 39/83  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86161.2 GT:GENE AAK86161.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 335817..336698 GB:FROM 335817 GB:TO 336698 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86161.2 GB:DB_XREF GI:159139594 LENGTH 293 SQ:AASEQ MVAEIFNHDICENNVVISPRSETAQDNEGLFGRIGTLETRLARNEREIDAAQSVRYRVFVEEMKARLPAEAMRRKRDFDAWDSVCDHLLVLDKSIEGDSEDQIVGTYRLLRQETALANNGFYSASEFDIAGLVARHPGKRFMELGRSCVLPEYRTKRTVELLWQGNWAYAVKHRMDAMIGCASFPGVQPEAHALALSFLHHNCLAKGEWEAVALPELYHEMDLVPVEALNTRKALNAMPPLIKGYMRLGAMFGSGAVVDHAFNTTDVLVVLPVSSIAGRYISYYGGEAERING GT:EXON 1|1-293:0| HM:PFM:NREP 1 HM:PFM:REP 100->158|PF00583|0.00075|25.6|39/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 47->249|1k4jA|6e-19|11.5|174/193|d.108.1.3| HM:SCP:REP 34->261|1kzfA_|1.4e-38|33.8|201/0|d.108.1.3|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 229 OP:NHOMOORG 213 OP:PATTERN -------------------------------------------------------------------- 1-------------21111-11--13111111111111----------------------1---1-1111--------------1-11--------------------------------------------------------1----------------------113--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------------1-----------11---1-11111111111111111-11111111111-11111111111111---22222222221111111111111211--------------------------------1--111111-11111111111111111111111111-11111111111111111--11111----------1111--------------------------------------------------------11----1-------1111-1-1111-1--1----1---1------------------------------------------------------------------------------------------------------111---------------------------1-11111111111111111------------------------11----------------111111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,21-32,289-290,292-294| PSIPRED cHHHHHcccccccccEEcccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEccccccccccEEEEEEEccHHHHHHcccccHHHHHcccHHHHHcccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHccccHHHccccccccccccccccccccccccHHHHccHHHHHHHHcccEEcccccccHHHccEEEEEEEEHHHccHHHHHHHccHHHcccc //