[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86169.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  380/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:222 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->126 2gemA PDBj 4e-10 26.4 %
:RPS:PDB   3->204 2a6aA PDBj 1e-17 23.2 %
:RPS:SCOP  3->95 1okjA1  c.55.1.9 * 6e-21 32.2 %
:HMM:SCOP  2->110 1okjA1 c.55.1.9 * 2.1e-28 44.3 %
:HMM:SCOP  111->202 1okjA2 c.55.1.9 * 0.00042 26.1 %
:RPS:PFM   29->95 PF00814 * Peptidase_M22 4e-14 53.7 %
:HMM:PFM   31->147 PF00814 * Peptidase_M22 9e-29 41.0 117/268  
:BLT:SWISS 1->126 Y388_HAEIN 4e-13 30.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86169.1 GT:GENE AAK86169.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 346963..347631 GB:FROM 346963 GB:TO 347631 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86169.1 GB:DB_XREF GI:15155262 LENGTH 222 SQ:AASEQ MIVLALDTSGVDCSACIYDNASDTVLGEVCETIGKGHAERLMAVIDGALQQAQLPLQKVERIAVTIGPGSFTGIRVGVAAARGFALSLGVEAVGVTTLETLALHHLAENPGRPVAVGLDAKRGETYLQIFGTDGSPLNEAALLSLDDAKDALSGFDGAVIGSAAPLFAGEETGSGPDHFPIAFVARAGARKSAGQPKPAPLYLRGPDARPQTGFALARQDVA GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 1->126|Y388_HAEIN|4e-13|30.1|123/236| SEG 96->108|ttletlalhhlae| SEG 140->153|aallslddakdals| BL:PDB:NREP 1 BL:PDB:REP 1->126|2gemA|4e-10|26.4|121/216| RP:PDB:NREP 1 RP:PDB:REP 3->204|2a6aA|1e-17|23.2|185/191| RP:PFM:NREP 1 RP:PFM:REP 29->95|PF00814|4e-14|53.7|67/260|Peptidase_M22| HM:PFM:NREP 1 HM:PFM:REP 31->147|PF00814|9e-29|41.0|117/268|Peptidase_M22| GO:PFM:NREP 2 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF00814|IPR000905| GO:PFM GO:0006508|"GO:proteolysis"|PF00814|IPR000905| RP:SCP:NREP 1 RP:SCP:REP 3->95|1okjA1|6e-21|32.2|90/106|c.55.1.9| HM:SCP:REP 2->110|1okjA1|2.1e-28|44.3|106/0|c.55.1.9|1/1|Actin-like ATPase domain| HM:SCP:REP 111->202|1okjA2|0.00042|26.1|92/110|c.55.1.9|1/1|Actin-like ATPase domain| OP:NHOMO 380 OP:NHOMOORG 380 OP:PATTERN -------------------------------------------------------------------- ----1---111----------1----------1111----1---1--1----1-----11--1-1-1-1-------------1----------1111--111111-1111-----------------------------11----1--------------------------------------1-------11111111111111111-111-1111111-111111111--111111111111111---11-1-1--1--1-11--11111---11111111111111111111111111111111111111--111----111-----------111--11111-1-1-11-111---111-11111-1----111111111111111111111111111111111-1111111111-111111111111111111-11-----11-------------1-1111--111---1111111111-1111-1--11--1---------------------------------1---------------------1----------11----1-1-----------111--11-----------------------------------111111-1111-111111111111111111111--1-1-1------1----------------------------------------111--------------------------111111111111--11----------11--11111111111111-111111-11--11111-111----------11111111-111111111111------------1111----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 195 STR:RPRED 87.8 SQ:SECSTR cEEEEEEcccccEEEEEEETTETEEEEEEEEcccGGGGGHHHHHHHHHHHHHTccGGGccEEEEEcccccHHHHHHHHHHHHHHHGGGTccEEEEcHHHcHHHHHHTccccEEEEEEEEccTTEEEEEEEEEccEEEEEEEEEEHHHHHHHHHHHcccEEccccc########cHHHHHHHHHHHHHTTccccGGG#TTHHHHc################## DISOP:02AL 220-222| PSIPRED cEEEEEEccccHHEEEEEEcccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHcccHHHccEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHcccccEEEEEEEcccEEEEEEEEEccccccHHHcccHHHHHHHHccccEEEEccccHHHHHHHHccccccccHHHHHHHHHcccccccccccEEcccHHHHHcccccccccccc //