[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86186.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:198 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86186.1 GT:GENE AAK86186.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(363158..363754) GB:FROM 363158 GB:TO 363754 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86186.1 GB:DB_XREF GI:15155281 LENGTH 198 SQ:AASEQ MPTASEVRLYLTGLWLLLLGDHNGARYLDLSERGMWRSFYSALWCLPAMLVSWLWLRAAFLASVPPGAETGFLFFFRLAMVEAICWIVPLLLIGMLLYAFGAREKFAPLVTTVNWLSLPFSYAYAVLILIAFFLPPLQGLIAILWLALLLSLVFAFSRIVRFFIRDQSLLVSAVVMTLLVPAMLLSEALQRFLGVYPA GT:EXON 1|1-198:0| TM:NTM 5 TM:REGION 5->27| TM:REGION 40->62| TM:REGION 75->97| TM:REGION 130->152| TM:REGION 167->189| SEG 9->19|lyltglwllll| SEG 137->152|lqgliailwlalllsl| OP:NHOMO 23 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111-------------111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHcccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //