[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86196.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:305 amino acids
:PSIPRED
:HMM:SCOP  43->148 1s7bA_ f.39.1.1 * 1.9e-06 22.9 %
:HMM:SCOP  206->306 1s7bA_ f.39.1.1 * 1.8e-09 23.8 %
:HMM:PFM   20->140 PF00892 * EamA 1.5e-09 18.6 118/126  
:HMM:PFM   201->302 PF00892 * EamA 1.7e-10 21.6 102/126  
:BLT:SWISS 74->142 YWFM_BACSU 2e-04 30.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86196.1 GT:GENE AAK86196.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 372820..373737 GB:FROM 372820 GB:TO 373737 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86196.1 GB:DB_XREF GI:15155293 LENGTH 305 SQ:AASEQ MELWIGITFASAFLQNLRSTLQKHLKGMMGTTGATFVRFVFGMPFALAYLAFLHLGLGRPLPVPNMSFAGWATVGAMAQIAATFLLVHLFSFRNFAVGTAYSRTEPAQAALFALIFIGESITGGTLAAIAISVAGVMLISVARTQVTPASFLTSIFSRTAGIGLASGAFFGLSSVAYRSASLALAPSLPAPDAMMQAGFTLVVVIVMQTVSMFLWIIWREREELPRIAKVWKPSLAVGFVGATASFGWFTAMTLQQAAVVKALAQVEMLFAFASTVLFFKEKINRLELSGCMLIVVGVLSLLAFG GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 74->142|YWFM_BACSU|2e-04|30.4|69/296| TM:NTM 9 TM:REGION 1->23| TM:REGION 34->56| TM:REGION 69->91| TM:REGION 114->136| TM:REGION 157->179| TM:REGION 196->218| TM:REGION 229->251| TM:REGION 257->279| TM:REGION 283->305| SEG 179->191|saslalapslpap| SEG 254->266|lqqaavvkalaqv| HM:PFM:NREP 2 HM:PFM:REP 20->140|PF00892|1.5e-09|18.6|118/126|EamA| HM:PFM:REP 201->302|PF00892|1.7e-10|21.6|102/126|EamA| HM:SCP:REP 43->148|1s7bA_|1.9e-06|22.9|105/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 206->306|1s7bA_|1.8e-09|23.8|101/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 61 OP:NHOMOORG 61 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------1111-111111----------------------1--11---1---11-----11-----111--------1----------------------------------------------1------------------1-----------------111-----------------------------------------------------------------------------------------1-11-11-11111-1-111-1111-11-----------------------------------------------------------------------------------------------------------------1---------------------1--------------------------------111-11111--1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcc //