[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86224.2
DDBJ      :             ferrichrome iron receptor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  360/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
f.4.3
:729 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->721 2grxA PDBj 3e-83 32.6 %
:RPS:PDB   62->729 1by3A PDBj 7e-80 33.4 %
:RPS:SCOP  62->729 1by3A  f.4.3.3 * 5e-78 33.4 %
:HMM:SCOP  24->729 1by5A_ f.4.3.3 * 8.4e-130 28.7 %
:RPS:PFM   74->174 PF07715 * Plug 5e-10 37.0 %
:HMM:PFM   494->726 PF00593 * TonB_dep_Rec 1.3e-31 19.7 233/277  
:HMM:PFM   71->174 PF07715 * Plug 4.8e-27 35.9 103/108  
:BLT:SWISS 40->729 FCT_DICD3 3e-92 35.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86224.2 GT:GENE AAK86224.2 GT:PRODUCT ferrichrome iron receptor GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 406406..408595 GB:FROM 406406 GB:TO 408595 GB:DIRECTION + GB:PRODUCT ferrichrome iron receptor GB:PROTEIN_ID AAK86224.2 GB:DB_XREF GI:159139623 LENGTH 729 SQ:AASEQ MKNLHGMFLSRLALGTAAVVLMGPVMGHAQETTVLKQITVEGQGAENATGPVRGYVAKKSATGSKTETETKAIPQSVSVVGRQEMDDRGAVTKIDEVLRYTPGVTAEPFGTDPDTDWFYIRGFQATQTGVFLDGLNLFSYGFGGFQMDAYGLERVEVLKGPASVLYGGANPGGIVQMVSKRAQDTPVRETEIGINNFGNAFFGFDLGDKVDAEGVWKYRVTGKVSGGDNYTDYSEDLRGFIMPQITFEPDAQTSATLYGYFSALDQVHVGNGFLPYVGTVVDAPFGKLDRKAFYGEPDIDNGRVYQSMVGYDVSHEFDNGWKISQNARYGHLYKHETGPYPGGWANADANGQPILDPITNDYMLTRFGYDGLSKVDSFGVDNRIEGQFDTGAVNHSPLFGLDYKYYRLDQVQACCGSNAIGALKPVYGSTQGTNFVYADNIVTQQQIGIYAQDQLRFGDGWLVTLNGRYDYVDTELNNRLPAGVSRRSNDDALSGRAGLAYEFDNGLTPYVSAATFFNPLIDTLADGTPASPEEGHQFEAGIKYEPSFFDGSITASVFKLVKDNAIVSYTAGGVTTSGQFGQVESTGFELEAKANLDENWKALASYSYTDLDITKDANPNLIGKSPWIVPAHTASLWVDYAFTDETFEGLSIGGGVRYQGKSWADAANTLRVSDAAVFDAAIRYEKNDWTASVNVANVFDKEYVKSCAGVSVCGWGDSRTITLKLSKKW GT:EXON 1|1-729:0| BL:SWS:NREP 1 BL:SWS:REP 40->729|FCT_DICD3|3e-92|35.6|660/735| SEG 192->204|iginnfgnaffgf| BL:PDB:NREP 1 BL:PDB:REP 38->721|2grxA|3e-83|32.6|675/702| RP:PDB:NREP 1 RP:PDB:REP 62->729|1by3A|7e-80|33.4|661/695| RP:PFM:NREP 1 RP:PFM:REP 74->174|PF07715|5e-10|37.0|100/108|Plug| HM:PFM:NREP 2 HM:PFM:REP 494->726|PF00593|1.3e-31|19.7|233/277|TonB_dep_Rec| HM:PFM:REP 71->174|PF07715|4.8e-27|35.9|103/108|Plug| GO:PFM:NREP 4 GO:PFM GO:0004872|"GO:receptor activity"|PF07715|IPR012910| GO:PFM GO:0005215|"GO:transporter activity"|PF07715|IPR012910| GO:PFM GO:0006810|"GO:transport"|PF07715|IPR012910| GO:PFM GO:0016020|"GO:membrane"|PF07715|IPR012910| RP:SCP:NREP 1 RP:SCP:REP 62->729|1by3A|5e-78|33.4|661/695|f.4.3.3| HM:SCP:REP 24->729|1by5A_|8.4e-130|28.7|676/0|f.4.3.3|1/1|Porins| OP:NHOMO 1808 OP:NHOMOORG 365 OP:PATTERN -------------------------------------------------------------------- 2------------------------------------------------------------------------------------1--331----------72--A16-1---------------1--------22----------811311--1--------23-G8J1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-3664-----323365D473281----------3-BB4BA7EC1-2-6333113221238134---83255---88888888-3374-66------------------------------13C234A8959BDDD9733337742555525D446477--44615955J21-B35H2-64C111132312F43374-1-------1--------1--111------1-C-52-----2----------13-----44131455551387A824278873525822---2---------83521734556466644-544454544556532443356648211433244444432422442231123--433343233343-------------15254111111--11-----A9AA82C-11G9CCCEFNDJ7GTJE2CAA----------332312212333119E9B8B94441111--------11-----------------------------------------------5- -------------------------------------------------------------------------------------------------------------------------------1------------------------------3------1----------------------8-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 702 STR:RPRED 96.3 SQ:SECSTR ###########################GGGEEEHHHHHHTcccccccTTcccccccccEEcTTTcccEEGGGccccEEEEEHHHHHHHccccTcGGGGTTcccEEccTTTTcccccccEEcccGGGcccEEcccccccccTTccccccGGGEEEEEEEEcccHHHHccccTTEEEEEEEcccccccEEEEEEEEETTTEEEEEEEEEEEccccccEEEEEEEEEEEEEcccTTcEEEEEEEEEEEEEcccTTEEEEEEEEEEEEcccccccccccccTTTcccTTcccccTTcccccTTcEEEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEETTcGGGTTcHHHHTccTTGGGcEEEEEEEEEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEEEEEccEETTcccccccccccccTTTEEEEEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEEETTTccEEEEEEEEEEEEEEEEEEccTTcEEEEEEEEEEEEccccccTTccccccEEEEEEEEEEEEcccccccEEEEEEEEEEEEEEEEEEcccccccEEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEcTTTTccTcccTTcccEEEEEEEEEEEcccTTTTEEEEEEEEEEccEEccTTcccEEccEEEEEEEEEEEccccEEEEEEEcTTccccEEEEEETTEEEEccccEEEEEEEEEc DISOP:02AL 1-7| PSIPRED ccccccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccccccccccEEccEEEEEEcccccHHHcccEEEEEcHHHHHHHcccccHHHHHHHcccEEEEcccccccccEEEEEEEcccccEEEEccEEccccccccccccHHHHcEEEEEEcccccccccccccEEEEEEEcccccccEEEEEEEEEccccEEEEEEEEEEEcccccEEEEEEEEEEccccEEccccccEEEEEEEEEEEccccEEEEEEEEEEEEccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEEccccccccccccEEEccccccEEEEEEEEEEEEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEEEEEEEccccccccccccccccccccccccccccEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEEccccccccccccccccEEEEEEEEEEEcccEEEEEEEEEEEEEcccccccccccccEEEEEEEEEEEEEccccEEEEEEEEEEEEEccEEEEccccccEEEEEEccEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEEccccccccccccccccEEEEEEEEEEEcccccccEEEEEEEEEEEEEEccccccEEEccEEEEEEEEEEEcccEEEEEEEEccccccEEEEEEccccEEEcccEEEEEEEEEEc //