[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86227.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->74 PF06169 * DUF982 6e-08 46.3 %
:HMM:PFM   8->76 PF06169 * DUF982 3.9e-23 46.4 69/76  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86227.2 GT:GENE AAK86227.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(410201..410443) GB:FROM 410201 GB:TO 410443 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86227.2 GB:DB_XREF GI:159140672 LENGTH 80 SQ:AASEQ MKNERWTEPVEVNLEAKGKSVVAGPFEALTLLTEGWPRTGGLSFVKARSACRAALDGRKSPEEARKCFTDAVSEMQKNPH GT:EXON 1|1-80:0| RP:PFM:NREP 1 RP:PFM:REP 8->74|PF06169|6e-08|46.3|67/76|DUF982| HM:PFM:NREP 1 HM:PFM:REP 8->76|PF06169|3.9e-23|46.4|69/76|DUF982| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--11-11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,78-81| PSIPRED cccccccccEEEEcccccEEEEccHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccc //