[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86255.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   82->139 2jxuA PDBj 9e-04 32.8 %
:HMM:PFM   6->135 PF05099 * TerB 3e-10 22.1 122/140  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86255.2 GT:GENE AAK86255.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(437495..437917) GB:FROM 437495 GB:TO 437917 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86255.2 GB:DB_XREF GI:159140674 LENGTH 140 SQ:AASEQ MLAMFKSLVGDKAKKFSGKTDFLEAVCAASALVATADGELDDKELLAAVAAVKSNAALSGAFDARAIETTMDKMCSRAVGRVGKAGLFKEIEDIKADHDMSETVLLVALDVADSGGISDDEKAVLAKIASTVELDLAKYL GT:EXON 1|1-140:0| SEG 25->36|avcaasalvata| SEG 45->59|llaavaavksnaals| BL:PDB:NREP 1 BL:PDB:REP 82->139|2jxuA|9e-04|32.8|58/153| HM:PFM:NREP 1 HM:PFM:REP 6->135|PF05099|3e-10|22.1|122/140|TerB| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 41.4 SQ:SECSTR #################################################################################HHHHHHHHHHHcccccHHHHHHHHHHHHHHHTTTccccTHHHHHHHHHHHTTcccccc# DISOP:02AL 1-2,6-7| PSIPRED cHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHc //