[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86258.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:99 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  34->91 1rzsA_ a.35.1.2 * 1.2e-07 34.5 %
:HMM:PFM   48->81 PF01381 * HTH_3 3.8e-05 32.4 34/55  
:HMM:PFM   40->52 PF12111 * PNPase_C 0.00037 61.5 13/39  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86258.1 GT:GENE AAK86258.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 439119..439418 GB:FROM 439119 GB:TO 439418 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86258.1 GB:DB_XREF GI:15155366 LENGTH 99 SQ:AASEQ MKGELSSFVHLSIACIDFKAVLLIALMETNLNQNGLIAVKGAAGGASAIARAIGVTPQAVAQWKAIPPEHVLKLEKAFGVSRHIQRADVFGPAELEAAE GT:EXON 1|1-99:0| TM:NTM 1 TM:REGION 5->27| SEG 37->54|iavkgaaggasaiaraig| HM:PFM:NREP 2 HM:PFM:REP 48->81|PF01381|3.8e-05|32.4|34/55|HTH_3| HM:PFM:REP 40->52|PF12111|0.00037|61.5|13/39|PNPase_C| HM:SCP:REP 34->91|1rzsA_|1.2e-07|34.5|58/0|a.35.1.2|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 96-99| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHccccHHHHHHccccHHcccHHHHHHHHHHHHHccccccHHHccccc //