Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86264.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86264.1 GT:GENE AAK86264.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 443103..443396 GB:FROM 443103 GB:TO 443396 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86264.1 GB:DB_XREF GI:15155372 LENGTH 97 SQ:AASEQ MTDLMPIVEILADCQTDAARADWLLRAPQGVIYRDHTTIRRVLQEAHFTLGVDALDVEFAAINATRLPDGGLPHTVVLGVHAVRSFLRDVVRKGGAQ GT:EXON 1|1-97:0| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------112------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 95-97| PSIPRED cccHHHHHHHHHHccccHHHHHHHHccccccEEcccHHHHHHHHHHHHHccccHHHHHHEEEcccccccccccHHHHHHHHHHHHHHHHHHHHcccc //