[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86271.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:248 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   117->146 PF09602 * PhaP_Bmeg 0.00015 36.7 30/165  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86271.1 GT:GENE AAK86271.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 448012..448758 GB:FROM 448012 GB:TO 448758 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86271.1 GB:DB_XREF GI:15155381 LENGTH 248 SQ:AASEQ MSFIRFAARICAVEAIKGNTVVGSNVLDSEIGVLDIAADGSLRTDKDKPFISVYTDGSKLIEGLELRSLASPGQLDIVFEAGVTTAHAVTDTETDESVILGMPATDATFEFHLDMALRQTGDALNDSENEWAEIFRSLCSSFQSASRSRISGDTNGVRLAAHQLKITANMVAEPLCGQPLNPGSPFAKFVAKCESDLAPNDPSMAEKIALIRAQLSGDANELQTAMRRYGLIYDEADAMLITPYEGSP GT:EXON 1|1-248:0| SEG 136->151|rslcssfqsasrsris| HM:PFM:NREP 1 HM:PFM:REP 117->146|PF09602|0.00015|36.7|30/165|PhaP_Bmeg| OP:NHOMO 8 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------2---1--1-------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 144-153, 246-248| PSIPRED cHHHHHHHHHHHHHHccccEEEccccccccccEEEEEccccccccccccEEEEEEcHHHHHHHHHHHHccccccEEEEEEccccEEEEEcccccccEEEEEccccccEEEEEEHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEHHHEEEEHHHHHccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHccEEEcccEEEEEcccccc //