[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86277.1
DDBJ      :             putative bacteriophage P2 tail protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   45->129 PF06995 * Phage_P2_GpU 9e-16 45.1 %
:HMM:PFM   10->131 PF06995 * Phage_P2_GpU 2.4e-36 31.9 119/121  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86277.1 GT:GENE AAK86277.1 GT:PRODUCT putative bacteriophage P2 tail protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 454649..455113 GB:FROM 454649 GB:TO 455113 GB:DIRECTION + GB:PRODUCT putative bacteriophage P2 tail protein GB:PROTEIN_ID AAK86277.1 GB:DB_XREF GI:15155387 LENGTH 154 SQ:AASEQ MTGVTSMMLGGFAFEGLGFGYQGVKRKVNTPWVDIPVGQTLNQQQWTGPTSDEVTISGVLFPEEFGGQSQLDGIIAASMAGTEMMLVTGDAAQGVIQGMFTVQSVEEDRSYINRRGEAGRNAYSITLKRSGSGTLPSAGGLVDRAASFLSELFR GT:EXON 1|1-154:0| SEG 9->20|lggfafeglgfg| RP:PFM:NREP 1 RP:PFM:REP 45->129|PF06995|9e-16|45.1|82/121|Phage_P2_GpU| HM:PFM:NREP 1 HM:PFM:REP 10->131|PF06995|2.4e-36|31.9|119/121|Phage_P2_GpU| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------1--------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccEEEEEccEEEEEcccccccEEEEcccccccHHHHccccccccccccccEEEEEEEEcccEEccHHHHHHHHHHHHcccccEEEEccccccEEEEEEEEEEccccEEEEEccccEEEEEEEEEEEEEccccHHHHccHHHHHHHHHHHHcc //