[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86281.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 47->131 RS7_THEEB 9e-04 33.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86281.1 GT:GENE AAK86281.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 459236..459649 GB:FROM 459236 GB:TO 459649 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86281.1 GB:DB_XREF GI:15155393 LENGTH 137 SQ:AASEQ MSSDSNFSEISPEEMEIIQSVLKSAGYNAALLGDDQRQFNTAAFLVMSLFLAGEKSADALAAQLKRRLGRASFHRPSYQSALAPYAIRGLPRNMRYVLQFSRKGSARSIEAEEQSWENEGGAVRRPLGHPHHRPQLF GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 47->131|RS7_THEEB|9e-04|33.8|80/156| OP:NHOMO 8 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----11112------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 104-121, 131-137| PSIPRED cccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHcccHHHHHHcccHHHHHHHHHHcccccccccHHHHHHccccccEEccccccccccccc //