[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86293.2
DDBJ      :             polysaccharide biosynthesis protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:400 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->257 PF01943 * Polysacc_synt 3.2e-15 20.6 247/273  
:BLT:SWISS 6->350 TUAB_BACSU 8e-08 22.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86293.2 GT:GENE AAK86293.2 GT:PRODUCT polysaccharide biosynthesis protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(468531..469733) GB:FROM 468531 GB:TO 469733 GB:DIRECTION - GB:PRODUCT polysaccharide biosynthesis protein GB:PROTEIN_ID AAK86293.2 GB:DB_XREF GI:159139646 LENGTH 400 SQ:AASEQ MSSAAQLLTFALLARHLGVEQFALYASITAVTNLGVQICGIGSQESLIRRVAQDRSMFPVMLGHSYLLSAATGVVLTIIGMVTIPVFFPTSETLLHTLITTFLILFTNLVLLKVISLSTQSFIAHSNFASANKLEVMFAVTRTIAAVVACLIFKVETVEAWALWNLAAHAVAAVISVKATGRLGRPIFRIVREEIRIGILFSTQFLFKAVRGNADILVLGAIASAEVLGSYSIARRILDSSYLSVEALNRLIYPGSASAALQGITKTIGRAYNVLKAALFIATGSALVIFIIAPFLPLLFGDEYVSLPIITRVLCWVVLPMAVAATALEALGASGRQDIRAKIWNSGNLLGSVIVAFFTWSFSISGTIGSYFLVETAIAAAVWIALLRLRRDEQVFAPAK GT:EXON 1|1-400:0| BL:SWS:NREP 1 BL:SWS:REP 6->350|TUAB_BACSU|8e-08|22.4|330/483| TM:NTM 11 TM:REGION 13->35| TM:REGION 62->84| TM:REGION 94->116| TM:REGION 134->156| TM:REGION 161->183| TM:REGION 211->233| TM:REGION 245->267| TM:REGION 270->292| TM:REGION 310->332| TM:REGION 344->365| TM:REGION 371->388| SEG 93->112|tllhtlittflilftnlvll| SEG 160->174|awalwnlaahavaav| SEG 319->333|lpmavaatalealga| HM:PFM:NREP 1 HM:PFM:REP 5->257|PF01943|3.2e-15|20.6|247/273|Polysacc_synt| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1----11---1---11----------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,394-394,398-401| PSIPRED ccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHEEEEEEEccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccHHHHHEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //