[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86304.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  108/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:213 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   28->104 PF02588 * DUF161 3.8e-10 28.0 75/82  
:HMM:PFM   121->201 PF02588 * DUF161 4e-11 22.8 79/82  
:BLT:SWISS 67->155 YITT_BACSU 2e-07 32.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86304.2 GT:GENE AAK86304.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 478100..478741 GB:FROM 478100 GB:TO 478741 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86304.2 GB:DB_XREF GI:159139654 LENGTH 213 SQ:AASEQ MDDTSARRRLNLWTSAPDRHSLLEDAQAILAGSMLISLGVTLFSAAGLLTGGVVGLAFLAHYASGFSFGAVFFLANLPFYYLAFRRLGLAFTVKTFCAIATTALLSEYMPGFFAFESINPIAAALFGGLTVAAGMLALFRHRTSLGGFGILALYLQDRFGWRAGLVQLAFDGMVLGCSFFVATPFVILCSILGALVMNLTLAVNHRNDRYIAM GT:EXON 1|1-213:0| BL:SWS:NREP 1 BL:SWS:REP 67->155|YITT_BACSU|2e-07|32.2|87/280| TM:NTM 4 TM:REGION 54->76| TM:REGION 87->109| TM:REGION 119->140| TM:REGION 177->199| SEG 45->60|aaglltggvvglafla| HM:PFM:NREP 2 HM:PFM:REP 28->104|PF02588|3.8e-10|28.0|75/82|DUF161| HM:PFM:REP 121->201|PF02588|4e-11|22.8|79/82|DUF161| OP:NHOMO 131 OP:NHOMOORG 109 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------1---111--1--------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------11-----------------------------------------------1--111----------------1-1--------------------------1-------------1---------11--------11111111111-------1-----1222222222111-1--1-21111-1----------1----------------------------------------------------------------------------11-112221---1----------------------1----1------------------------------------------------------1111----1------------------------------------22--1------------------------------11111--------------------------------------------------------212---------------------1-------------11---1-------------1111111112222211-1111111--------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,8-17| PSIPRED cccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccc //