[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86329.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86329.1 GT:GENE AAK86329.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 505736..506035 GB:FROM 505736 GB:TO 506035 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86329.1 GB:DB_XREF GI:15155449 LENGTH 99 SQ:AASEQ MAARKAAEATLKLSPVLDLNEASALHGKLMTLRGAPLSVDASEVERIGALCAQVLMAGAKSWEEDGKPFGFARVSDAFDKTMKLIGVDIDHLLPKEMQK GT:EXON 1|1-99:0| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----1------------------------------------111111111111-----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 98-99| PSIPRED cccccccccEEEcccccccHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccHHHHHHHHHHHHccccccccHHHHcc //